TkA03G430610 | RubberDandelionOmics

Gene overview

TkA03G430610

Reference: TK1151 Chr: Chr03 Coordinates: 107182230-107184675 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2234 bp · TkA03G430610|TK1151|cDNA

AAACACGTGTTTTAAATAGAGAAGAGTGTGATAGTCTCCATTTGGTAGTCCTACCAAAATCATGCTATCCGTTATAAGAACATATGGGAGAAAGAAAATCTAAACACAACTCCATCATCTTCTTCCCTAGAAATCGGAAAGCTTTCTTACGCATATTAGAAAACCCTGAAACACCCATAGAGCTTCTAATATTTTCATGCTAACTTGATCACCTTTCTGGGGTTTTGAAGTTTGAATTCGCAAGGATGATCCGATTACCA...

CDS

Download CDS FASTA

1704 bp · TkA03G430610|TK1151|CDS

ATGATCCGATTACCAGAAAAGCCGAACACTTTTCTGAACAACAGATGGCTAGTTTTTGTGGCTTCTATGTGGGTTCAATCTTGCTCCGGGATTGGGTACATGTACGGAAGCATATCGCCGGTGATCAAGAGCACCATGGGTTACAATCAGCGGCAGATTGCAGTGTTAGGTGTCGCTAAAGATATCGGTGATGCTATCGGATTCGTCGCCGGAAGTTTGTGTGAAGTTGCTCCGATTTGGGTGGTTCTTTTCATCGGCGT...

Protein

Download Protein FASTA

567 aa · TkA03G430610|TK1151|PROTEIN

MIRLPEKPNTFLNNRWLVFVASMWVQSCSGIGYMYGSISPVIKSTMGYNQRQIAVLGVAKDIGDAIGFVAGSLCEVAPIWVVLFIGVAQNFFGYGLVWLTVNGTLPELRLWVLCVCIFVGTNGETYFNTGALVSGVQNFPKSRGPVVGILKGFAGLSGAILTQVYTMFNFPDESAIIFVVAVGPTIVISSVMFIVRPVGGHKQARPSDNTSFLALYGVCLILAAYLLAVLILQDLVNLNQTTIIVLTIGLVILVLLPVTI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G430610`
TK1151 ID	TkA03G430610
OH-1004 ID	LXL04_031945
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	80.100
Protein coverage (%)	TK1151 99.471 / OH-1004 99.647 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA03G430610`
Location	Chr03:107182230-107184675 (+)
Description	Similar to NFD4: Protein NUCLEAR FUSION DEFECTIVE 4
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_031945` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0000741 karyogamy Biological Process GO:0009651 response to salt stress Biological Process GO:0010197 polar nucleus fusion Biological Process GO:0005634 nucleus Cellular Component GO:0005739 mitochondrion Cellular Component GO:0016020 membrane Cellular Component
KEGG gene cross-reference	ath:AT1G31470 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.382

Rank 1 · TkA03G430610 · TK1151

Lysosome / Vacuole0.341

Rank 2 · TkA03G430610 · TK1151

Endoplasmic reticulum0.149

Rank 3 · TkA03G430610 · TK1151

Cytoplasm0.102

Rank 4 · TkA03G430610 · TK1151

Golgi apparatus0.089

Rank 5 · TkA03G430610 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF06813Nodulin-like15-262 aa

PF26566PH_40209-295 aa

PF02790COX2_TM232-288 aa

PF23262NFD4_C349-558 aa

PF06813Nodulin-like482-536 aa

PF26566PH_40530-552 aa

PF02790COX2_TM539-548 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G430610	`PF06813`	Nodulin-like	15	262	2.3e-88	296.7
TkA03G430610	`PF26566`	PH_40	209	295	0.058	14.1
TkA03G430610	`PF02790`	COX2_TM	232	288	4.6	8.2
TkA03G430610	`PF23262`	NFD4_C	349	558	5.5e-19	69.5
TkA03G430610	`PF06813`	Nodulin-like	482	536	2.3e-88	296.7
TkA03G430610	`PF26566`	PH_40	530	552	0.058	14.1
TkA03G430610	`PF02790`	COX2_TM	539	548	4.6	8.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card