TkA03G430540 | RubberDandelionOmics

Gene overview

TkA03G430540

Reference: TK1151 Chr: Chr03 Coordinates: 107169518-107170128 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

366 bp · TkA03G430540|TK1151|cDNA

ATGAAGAGAATATTTTTGTTCATTTCACTTAACATGACTTGTTCTACCGCCGAATTGTCTATTGATCTTCTGTCTTGTCGAACAGGTTTGGTGTCAGATGCATTTCATCTTACGTTTGGCTATGGCGTTTTGACATTTTCTTTATTCACCATGGCTGCTTCACGGAGAAAAGCTGATCGAGTCTACACTTATGGGTACAAAAGGCTAGAAGTTCTATCAGCTTTAACCTTTCTTTTAGACAGCTATTTCTTATGTTTATG...

CDS

Download CDS FASTA

366 bp · TkA03G430540|TK1151|CDS

ATGAAGAGAATATTTTTGTTCATTTCACTTAACATGACTTGTTCTACCGCCGAATTGTCTATTGATCTTCTGTCTTGTCGAACAGGTTTGGTGTCAGATGCATTTCATCTTACGTTTGGCTATGGCGTTTTGACATTTTCTTTATTCACCATGGCTGCTTCACGGAGAAAAGCTGATCGAGTCTACACTTATGGGTACAAAAGGCTAGAAGTTCTATCAGCTTTAACCTTTCTTTTAGACAGCTATTTCTTATGTTTATG...

Protein

Download Protein FASTA

121 aa · TkA03G430540|TK1151|PROTEIN

MKRIFLFISLNMTCSTAELSIDLLSCRTGLVSDAFHLTFGYGVLTFSLFTMAASRRKADRVYTYGYKRLEVLSALTFLLDSYFLCLCRFTWVLKHFMLLYKMNLNTSNSFILTLPFLNLKV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G430540`
TK1151 ID	TkA03G430540
OH-1004 ID	LXL04_009376
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	98.500
Protein coverage (%)	TK1151 55.372 / OH-1004 79.762 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G430540

Location Chr03:107169518-107170128 (+)

Description Similar to MTPC2: Metal tolerance protein C2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g12100`	Involved in sequestration of excess metal in the cytoplasm into vacuoles to maintain metal homeostasis.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009376 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006506 GPI anchor biosynthetic process Biological Process

GO:0006824 cobalt ion transport Biological Process

GO:0006829 zinc ion transport Biological Process

GO:0006882 intracellular zinc ion homeostasis Biological Process

GO:0009624 response to nematode Biological Process

GO:0010043 response to zinc ion Biological Process

GO:0030001 metal ion transport Biological Process

GO:0030070 insulin processing Biological Process

GO:0062111 zinc ion import into organelle Biological Process

GO:0071577 zinc ion transmembrane transport Biological Process

GO:0071578 zinc ion import across plasma membrane Biological Process

GO:1904257 zinc ion import into Golgi lumen Biological Process

KEGG gene cross-reference

ath:AT3G12100

dre:436594

gga:427173

hsa:64924

mmu:69048

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.458

Rank 1 · TkA03G430540 · TK1151

Cell membrane0.152

Rank 2 · TkA03G430540 · TK1151

Nucleus0.142

Rank 3 · TkA03G430540 · TK1151

Cytoplasm0.135

Rank 4 · TkA03G430540 · TK1151

Lysosome / Vacuole0.122

Rank 5 · TkA03G430540 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01545Cation_efflux4-79 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G430540	`PF01545`	Cation_efflux	4	79	5.4e-10	40.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q6ICY4`	Arabidopsis thaliana	sp\|Q6ICY4\|MTPC2_ARATH Metal tolerance protein C2	69.700%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card