TkA03G413690 | RubberDandelionOmics

Gene overview

TkA03G413690

Reference: TK1151 Chr: Chr03 Coordinates: 102881267-102884707 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

456 bp · TkA03G413690|TK1151|cDNA

GTATACTCCAGATCTGTATTCGATGCTCATGGCTACGAATTTGGAATCTTCTTACCACATGAGTCAACTCACACATCCTCTTCTAAAGGCTTCCGGAGCTGGAAGCATCGTGTTCATCTCCTCTTAGCAGGTCTGGTTCACGTAGGTGTCGGATCTGTTTACAGTGCCGCCAAAGCTGCCATGAATCAACTTACAAAGAATTTAGCATGTGAATGGGCGAAATACAACATTAGGGCTAATTCTGTAGCACCGTGGTTCAC...

CDS

Download CDS FASTA

456 bp · TkA03G413690|TK1151|CDS

GTATACTCCAGATCTGTATTCGATGCTCATGGCTACGAATTTGGAATCTTCTTACCACATGAGTCAACTCACACATCCTCTTCTAAAGGCTTCCGGAGCTGGAAGCATCGTGTTCATCTCCTCTTAGCAGGTCTGGTTCACGTAGGTGTCGGATCTGTTTACAGTGCCGCCAAAGCTGCCATGAATCAACTTACAAAGAATTTAGCATGTGAATGGGCGAAATACAACATTAGGGCTAATTCTGTAGCACCGTGGTTCAC...

Protein

Download Protein FASTA

151 aa · TkA03G413690|TK1151|PROTEIN

VYSRSVFDAHGYEFGIFLPHESTHTSSSKGFRSWKHRVHLLLAGLVHVGVGSVYSAAKAAMNQLTKNLACEWAKYNIRANSVAPWFTKTSLIKEVLDNKEFLDSVASRTPMKRLGEANEVSSLVVFLFLPAASYITGQTIAVDGGFSVNGF

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G413690`
TK1151 ID	TkA03G413690
OH-1004 ID	LXL04_035058
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	64.500
Protein coverage (%)	TK1151 72.848 / OH-1004 40.146 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G413690

Location Chr03:102881267-102884707 (+)

Description Similar to SDR: Tropinone reductase homolog At2g29360

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g06060`	Tropinone reductase homolog At5g06060.	No verified direct reference in this release
`At2g29360`	Oxidoreductase active on cyclic ketones, but not on tropinone or nortropinone.	No verified direct reference in this release
`At2g29370`	Tropinone reductase homolog At2g29370.	No verified direct reference in this release
`At2g29290`	Tropinone reductase homolog At2g29290.	No verified direct reference in this release
`At2g29170`	Tropinone reductase homolog At2g29170.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035058 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0002213 defense response to insect Biological Process

GO:0031347 regulation of defense response Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005777 peroxisome Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0004022 alcohol dehydrogenase (NAD+) activity Molecular Function

GO:0016491 oxidoreductase activity Molecular Function

GO:0050356 tropine dehydrogenase activity Molecular Function

GO:0050358 tropinone reductase activity Molecular Function

KEGG gene cross-reference

ath:AT2G29290

ath:AT2G29350

ath:AT2G29360

ath:AT5G06060

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Peroxisome0.554

Rank 1 · TkA03G413690 · TK1151

Cytoplasm0.199

Rank 2 · TkA03G413690 · TK1151

Mitochondrion0.142

Rank 3 · TkA03G413690 · TK1151

Nucleus0.084

Rank 4 · TkA03G413690 · TK1151

Endoplasmic reticulum0.059

Rank 5 · TkA03G413690 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00106adh_short43-98 aa

PF13561adh_short_C247-147 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G413690	`PF00106`	adh_short	43	98	7.6e-13	49.1
TkA03G413690	`PF13561`	adh_short_C2	47	147	2.1e-30	106.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LHT0`	Arabidopsis thaliana	sp\|Q9LHT0\|TRNHF_ARATH Tropinone reductase homolog At5g06060	66.400%	Swiss-Prot	High
`Q9ZW19`	Arabidopsis thaliana	sp\|Q9ZW19\|TRNHC_ARATH Tropinone reductase homolog At2g29360	66.400%	Swiss-Prot	High
`Q9ZW20`	Arabidopsis thaliana	sp\|Q9ZW20\|TRNHD_ARATH Tropinone reductase homolog At2g29370	64.500%	Swiss-Prot	High
`Q9ZW13`	Arabidopsis thaliana	sp\|Q9ZW13\|TRNH6_ARATH Tropinone reductase homolog At2g29290	63.600%	Swiss-Prot	High
`Q9ZW04`	Arabidopsis thaliana	sp\|Q9ZW04\|TRNH4_ARATH Tropinone reductase homolog At2g29170	65.100%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card