TkA03G338060 | RubberDandelionOmics

Gene overview

TkA03G338060

Reference: TK1151 Chr: Chr03 Coordinates: 83149194-83149646 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

423 bp · TkA03G338060|TK1151|cDNA

ATGAAGAAGATCAACGTGATTCTACGAAAATGCAAGTCGTTATCGAAACAAATAGGCAGAACGTCATCGTTCAGCAGCTTGGGATCTAAGTCCGCCAGACATCATCACCACCACGATGGTGGCACCGGAGGAGGAATAGTCTGGAGTACGAATGCAATCTCTGTTTACGGCGAGGAATCAGAGCATAATGAAACAGTATTCGTCGGAAGCGCGAGGAAACGGTACGTTATTAGCTCGAAGTATCTGAGTCATCCACTTGT...

CDS

Download CDS FASTA

423 bp · TkA03G338060|TK1151|CDS

ATGAAGAAGATCAACGTGATTCTACGAAAATGCAAGTCGTTATCGAAACAAATAGGCAGAACGTCATCGTTCAGCAGCTTGGGATCTAAGTCCGCCAGACATCATCACCACCACGATGGTGGCACCGGAGGAGGAATAGTCTGGAGTACGAATGCAATCTCTGTTTACGGCGAGGAATCAGAGCATAATGAAACAGTATTCGTCGGAAGCGCGAGGAAACGGTACGTTATTAGCTCGAAGTATCTGAGTCATCCACTTGT...

Protein

Download Protein FASTA

140 aa · TkA03G338060|TK1151|PROTEIN

MKKINVILRKCKSLSKQIGRTSSFSSLGSKSARHHHHHDGGTGGGIVWSTNAISVYGEESEHNETVFVGSARKRYVISSKYLSHPLVNALIEKLKAVGNDDESVINCEVVLFDHLLWMLENADFNVTSDCLDELADLYSS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G338060`
TK1151 ID	TkA03G338060
OH-1004 ID	LXL04_008748
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	92.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G338060

Location Chr03:83149194-83149646 (+)

Description Similar to SAUR76: Auxin-responsive protein SAUR76

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g20820`	May be involved in the regulation of ethylene receptor signaling.	Characterization of a small auxin-up RNA (SAUR)-like gene involved in Arabidopsis thaliana development.2013 · DOI: 10.1371/journal.pone.0082596
`At1g72430`	May be involved in the regulation of ethylene receptor signaling.	No verified direct reference in this release
`At1g17345`	May be involved in the regulation of ethylene receptor signaling.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_008748 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009733 response to auxin Biological Process

GO:0009873 ethylene-activated signaling pathway Biological Process

GO:0071456 cellular response to hypoxia Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT1G17345

ath:AT1G72430

ath:AT5G20820

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.512

Rank 1 · TkA03G338060 · TK1151

Nucleus0.356

Rank 2 · TkA03G338060 · TK1151

Cell membrane0.267

Rank 3 · TkA03G338060 · TK1151

Endoplasmic reticulum0.048

Rank 4 · TkA03G338060 · TK1151

Plastid0.027

Rank 5 · TkA03G338060 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02519Auxin_inducible10-123 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G338060	`PF02519`	Auxin_inducible	10	123	5.4e-15	56.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q29PU2`	Arabidopsis thaliana	sp\|Q29PU2\|SAU76_ARATH Auxin-responsive protein SAUR76	42.400%	Swiss-Prot	Medium
`Q9C9E1`	Arabidopsis thaliana	sp\|Q9C9E1\|SAU78_ARATH Auxin-responsive protein SAUR78	37.900%	Swiss-Prot	Medium
`Q9LQI6`	Arabidopsis thaliana	sp\|Q9LQI6\|SAU77_ARATH Auxin-responsive protein SAUR77	38.200%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card