RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA03G325960
Reference: TK1151 Chr: Chr03 Coordinates: 80097276-80101562 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

2359 bp · TkA03G325960|TK1151|cDNA

AAAATATAGGGTCTTTTATGAAAATAAGGGCTTAAATAATCGCATATCTAGATTTGACCGAAACCCTTCCGCAAAGGAATACCAGTTTTATGAGTTTGTCAGCACGATAGAGAAGACCAAAAAACCAGCCGCCAAAACAATCACAATTCTGCACCTCTGATTCCATCGATGGCTGGAGGTGCTTCTGCTATCAATTTAAACTCTACCACCACCGTTCGAATCGTTGTTGCCGGTGACCGGGGCACCGGTAAGTCCAGCCT...

CDS

Download CDS FASTA

1929 bp · TkA03G325960|TK1151|CDS

ATGGCTGGAGGTGCTTCTGCTATCAATTTAAACTCTACCACCACCGTTCGAATCGTTGTTGCCGGTGACCGGGGCACCGGTAAGTCCAGCCTAATTGTCACTGCTGCTGCCGAAGCTTTCCCCGCTAATGTCCCTCCCGTTTTGCCTCCTACTAGGTTGCCGGAGGATATGTTCCCTGACCATGTCCCCGTCAACGTCATTGATACGTCTTCTAGCATGGAAAATAGAAGCAGACTTGCTGATGAACTGAAGAGTGCAGA...

Protein

Download Protein FASTA

642 aa · TkA03G325960|TK1151|PROTEIN

MAGGASAINLNSTTTVRIVVAGDRGTGKSSLIVTAAAEAFPANVPPVLPPTRLPEDMFPDHVPVNVIDTSSSMENRSRLADELKSADAVILTYACDKPSTLDRLSTFWLPELRRLEVRVPVIVVGCKLDLRDEQQAVSLEQVMSPIMQQFREIETCIECSAFKHIQLPEVFYYAQKAVLHPTAPLFDQEAQTLKPRCVRALKRIFILCDHDRDGALSDAELNDFQVKCFNAPLQPSEIVGVKRVVQEKLSEGVNENGLTL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA03G325960
TK1151 IDTkA03G325960
OH-1004 IDLXL04_014157
Relationship / confidenceMulti Source To Oh1004 / Complex relationship
Protein identity (%)85.600
Protein coverage (%)TK1151 99.844 / OH-1004 99.846
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA03G325960
LocationChr03:80097276-80101562 (+)
DescriptionSimilar to MIRO1: Mitochondrial Rho GTPase 1
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At5g27540 Mitochondrial GTPase required to maintain proper development, morphology and intracellular distribution of mitochondria, which in turn are essential for the progress of embryonic cell division, development of haploid male and female gametes, and pollen tube growth.
EMB2473/MIRO1, an Arabidopsis Miro GTPase, is required for embryogenesis and influences mitochondrial morphology in pollen.2008 · DOI: 10.1105/tpc.107.055756
MIRO1 influences the morphology and intracellular distribution of mitochondria during embryonic cell division in Arabidopsis.2011 · DOI: 10.1007/s00299-010-0926-5
Arabidopsis thaliana MIRO1 and MIRO2 GTPases are unequally redundant in pollen tube growth and fusion of polar nuclei during female gametogenesis.2011 · DOI: 10.1371/journal.pone.0018530
At3g63150 Calcium-binding mitochondrial GTPase involved in calcium signaling during salt stress response.
Arabidopsis thaliana MIRO1 and MIRO2 GTPases are unequally redundant in pollen tube growth and fusion of polar nuclei during female gametogenesis.2011 · DOI: 10.1371/journal.pone.0018530
At3g05310 Mitochondrial GTPase that may be involved in mitochondrion development. No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_014157 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0000001 mitochondrion inheritance Biological Process
GO:0007005 mitochondrion organization Biological Process
GO:0009737 response to abscisic acid Biological Process
GO:0009793 embryo development ending in seed dormancy Biological Process
GO:0009860 pollen tube growth Biological Process
GO:0010821 regulation of mitochondrion organization Biological Process
GO:0015886 heme transport Biological Process
GO:0055091 phospholipid homeostasis Biological Process
GO:1990456 mitochondrion-endoplasmic reticulum membrane tethering Biological Process
GO:0005739 mitochondrion Cellular Component
GO:0005741 mitochondrial outer membrane Cellular Component
GO:0009536 plastid Cellular Component
KEGG gene cross-reference
ath:AT3G05310
ath:AT3G63150
ath:AT5G27540
cnb:CNBF0860
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.342
Rank 1 · TkA03G325960 · TK1151
Cell membrane0.222
Rank 2 · TkA03G325960 · TK1151
Nucleus0.170
Rank 3 · TkA03G325960 · TK1151
Mitochondrion0.157
Rank 4 · TkA03G325960 · TK1151
Golgi apparatus0.140
Rank 5 · TkA03G325960 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF10236DAP310-42 aa
PF01637ATPase_211-36 aa
PF00025Arf13-169 aa
PF05673DUF81515-38 aa
PF13479AAA_2416-35 aa
PF00071Ras17-178 aa
PF08477Roc17-129 aa
PF01926MMR_HSR117-93 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA03G325960PF10236DAP310420.02414.6
TkA03G325960PF01637ATPase_211360.01216.1
TkA03G325960PF00025Arf131690.0003420.8
TkA03G325960PF05673DUF81515380.3310.8
TkA03G325960PF13479AAA_2416350.02315.1
TkA03G325960PF00071Ras171786.3e-2175.3
TkA03G325960PF08477Roc171291.9e-0938.5
TkA03G325960PF01926MMR_HSR117939.4e-0626.4
TkA03G325960PF09439SRPRB17360.001918.4
TkA03G325960PF03193RsgA_GTPase17330.3311.5
TkA03G325960PF00350Dynamin_N18321.9e-0525.4
TkA03G325960PF13555AAA_2918320.001519.0
TkA03G325960PF13401AAA_2218860.00717.4
TkA03G325960PF13191AAA_1618390.008717.3
TkA03G325960PF13173AAA_1418400.1213.1
TkA03G325960PF03193RsgA_GTPase871430.3311.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q8RXF8Arabidopsis thalianasp|Q8RXF8|MIRO1_ARATH Mitochondrial Rho GTPase 171.500%Swiss-ProtHigh
F4J0W4Arabidopsis thalianasp|F4J0W4|MIRO2_ARATH Mitochondrial Rho GTPase 261.300%Swiss-ProtHigh
Q9MA88Arabidopsis thalianasp|Q9MA88|MIRO3_ARATH Mitochondrial Rho GTPase 354.000%Swiss-ProtHigh

JBrowse

View in Genome Browser