TkA03G303630 | RubberDandelionOmics

Gene overview

TkA03G303630

Reference: TK1151 Chr: Chr03 Coordinates: 74677667-74681704 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1314 bp · TkA03G303630|TK1151|cDNA

ATGTCAGTCTCCGATGCCCCTTTTTCTTGTAGTGCTCGATTGGTTGCTAAAGGGTATACACAAAAGAAGGGTACTAATTTTCAAGAAACTTTCTCACCAGTTTCTCGAAAGGATTCCCTTAGGATCGAGATGGCCCTCGTAGCTCATGGACGTCAAAACAGATTTTCTCACCAAATGGACGTCAAAACAGATTTTCTTAATGGAGATTTACATGAAAATGTTTACATGACCCAACCTGAAGGTTTTATTTCTGAGTGTCA...

CDS

Download CDS FASTA

1314 bp · TkA03G303630|TK1151|CDS

ATGTCAGTCTCCGATGCCCCTTTTTCTTGTAGTGCTCGATTGGTTGCTAAAGGGTATACACAAAAGAAGGGTACTAATTTTCAAGAAACTTTCTCACCAGTTTCTCGAAAGGATTCCCTTAGGATCGAGATGGCCCTCGTAGCTCATGGACGTCAAAACAGATTTTCTCACCAAATGGACGTCAAAACAGATTTTCTTAATGGAGATTTACATGAAAATGTTTACATGACCCAACCTGAAGGTTTTATTTCTGAGTGTCA...

Protein

Download Protein FASTA

437 aa · TkA03G303630|TK1151|PROTEIN

MSVSDAPFSCSARLVAKGYTQKKGTNFQETFSPVSRKDSLRIEMALVAHGRQNRFSHQMDVKTDFLNGDLHENVYMTQPEGFISECQEHLVCKLKKSIYGLKQASRQWYLKFDEVMKKNDFIMNQVDQCIYLKMSGRNFIILVLYVDDILLASSNIDLLHESKRLLSHHFDMKDLGEASYVIGIEIHRDRSQGTLRLSQKAYIEHVLGRYNMQQCSPSVAPVVEGDVSGSFQCPKTETERDQMKLITYASVVGSLMYAQV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G303630`
TK1151 ID	TkA03G303630
OH-1004 ID	LXL04_008966
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	96.200
Protein coverage (%)	TK1151 84.211 / OH-1004 15.693 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA03G303630`
Location	Chr03:74677667-74681704 (+)
Description	Similar to Retrovirus-related Pol polyprotein from transposon TNT 1-94
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_008966` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006508 proteolysis Biological Process GO:0015074 DNA integration Biological Process GO:0003676 nucleic acid binding Molecular Function GO:0003964 RNA-directed DNA polymerase activity Molecular Function GO:0004190 aspartic-type endopeptidase activity Molecular Function GO:0004519 endonuclease activity Molecular Function GO:0008270 zinc ion binding Molecular Function
KEGG gene cross-reference	No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.623

Rank 1 · TkA03G303630 · TK1151

Nucleus0.288

Rank 2 · TkA03G303630 · TK1151

Mitochondrion0.110

Rank 3 · TkA03G303630 · TK1151

Peroxisome0.068

Rank 4 · TkA03G303630 · TK1151

Cell membrane0.043

Rank 5 · TkA03G303630 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07727RVT_211-223 aa

PF14704DERM81-117 aa

PF14704DERM226-280 aa

PF14704DERM388-404 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G303630	`PF07727`	RVT_2	11	223	2.8e-62	211.2
TkA03G303630	`PF14704`	DERM	81	117	0.075	13.9
TkA03G303630	`PF14704`	DERM	226	280	0.075	13.9
TkA03G303630	`PF14704`	DERM	388	404	0.075	13.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card