TkA03G286070 | RubberDandelionOmics

Gene overview

TkA03G286070

Reference: TK1151 Chr: Chr03 Coordinates: 70616616-70617718 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

615 bp · TkA03G286070|TK1151|cDNA

ATGTTAATCGACGACCCCGAGCCCCAAAACGAACAAATCGATGCTATTCCTGATGAATTCAATCCTAATTATCTCAAAGCTTATTACGGTTCAATAAATGAAGTTAATCAAATTGCACAGATCTGCTACCATGTGCTTGGGCTGGTACATGGGATCTGGACCCCCATACCTCGAGCTATGAAAGACTACATTGCAACCCCAAAGCCCAATGGTTATCAGAGCCTTCTGACTTGCATTTATCCTTTTCAAATTAGAACTGA...

CDS

Download CDS FASTA

615 bp · TkA03G286070|TK1151|CDS

ATGTTAATCGACGACCCCGAGCCCCAAAACGAACAAATCGATGCTATTCCTGATGAATTCAATCCTAATTATCTCAAAGCTTATTACGGTTCAATAAATGAAGTTAATCAAATTGCACAGATCTGCTACCATGTGCTTGGGCTGGTACATGGGATCTGGACCCCCATACCTCGAGCTATGAAAGACTACATTGCAACCCCAAAGCCCAATGGTTATCAGAGCCTTCTGACTTGCATTTATCCTTTTCAAATTAGAACTGA...

Protein

Download Protein FASTA

204 aa · TkA03G286070|TK1151|PROTEIN

MLIDDPEPQNEQIDAIPDEFNPNYLKAYYGSINEVNQIAQICYHVLGLVHGIWTPIPRAMKDYIATPKPNGYQSLLTCIYPFQIRTEEMDLIAERGIAAHYSGKVIVNGLVRHTVANDKHMKGKPICLNNANVALRIGWLNSIREWQEEFVGNMSSREFVDTITKDLLGSRVFVFTPRGEIKNLPKGATVIDYGYMIHTDIGNN

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G286070`
TK1151 ID	TkA03G286070
OH-1004 ID	LXL04_031819
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	78.500
Protein coverage (%)	TK1151 100.000 / OH-1004 88.931 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G286070

Location Chr03:70616616-70617718 (+)

Description Similar to RSH1: Putative GTP diphosphokinase RSH1, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`UniProt: P0DKG8`	May be involved in a rapid plant ppGpp (guanosine 3'-diphosphate 5'-diphosphate)-mediated response to pathogens and other stresses.	No verified direct reference in this release
`At4g02260`	May be involved in a rapid plant ppGpp (guanosine 3'-diphosphate 5'-diphosphate)-mediated response to pathogens and other stresses (By similarity).	Expression profiling of four RelA/SpoT-like proteins, homologues of bacterial stringent factors, in Arabidopsis thaliana.2008 · DOI: 10.1007/s00425-008-0758-5

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0340900`	May be involved in a rapid plant ppGpp (guanosine 3'-diphosphate 5'-diphosphate)-mediated response to pathogens and other stresses.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031819 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009611 response to wounding Biological Process

GO:0010150 leaf senescence Biological Process

GO:0015949 nucleobase-containing small molecule interconversion Biological Process

GO:0015969 guanosine tetraphosphate metabolic process Biological Process

GO:0015970 guanosine tetraphosphate biosynthetic process Biological Process

GO:0015979 photosynthesis Biological Process

GO:0042594 response to starvation Biological Process

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0005524 ATP binding Molecular Function

GO:0005525 GTP binding Molecular Function

GO:0008728 GTP diphosphokinase activity Molecular Function

KEGG gene cross-reference

ath:AT4G02260

dosa:Os03g0340900

sar:SAR1714

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.249

Rank 1 · TkA03G286070 · TK1151

Plastid0.181

Rank 2 · TkA03G286070 · TK1151

Extracellular0.162

Rank 3 · TkA03G286070 · TK1151

Mitochondrion0.137

Rank 4 · TkA03G286070 · TK1151

Peroxisome0.097

Rank 5 · TkA03G286070 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF28864F59B10_3_N14-47 aa

PF04607RelA_SpoT39-101 aa

PF28864F59B10_3_N74-82 aa

PF04607RelA_SpoT165-174 aa

PF02824TGS172-203 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G286070	`PF28864`	F59B10_3_N	14	47	0.043	14.3
TkA03G286070	`PF04607`	RelA_SpoT	39	101	2.3e-14	54.4
TkA03G286070	`PF28864`	F59B10_3_N	74	82	0.043	14.3
TkA03G286070	`PF04607`	RelA_SpoT	165	174	2.3e-14	54.4
TkA03G286070	`PF02824`	TGS	172	203	2.6e-08	34.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P0DKG8`	Arabidopsis thaliana	sp\|P0DKG8\|RSH1L_ARATH Putative GTP diphosphokinase RSH1, chloroplastic	65.900%	Swiss-Prot	High
`F4JHA2`	Arabidopsis thaliana	sp\|F4JHA2\|RSH1C_ARATH Putative GTP diphosphokinase RSH1, chloroplastic	65.500%	Swiss-Prot	High
`Q9AYT5`	Oryza sativa subsp. japonica	sp\|Q9AYT5\|RSH1_ORYSJ Putative GTP diphosphokinase RSH1, chloroplastic	67.600%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card