TkA03G077850 | RubberDandelionOmics

Gene overview

TkA03G077850

Reference: TK1151 Chr: Chr03 Coordinates: 19862076-19862501 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

426 bp · TkA03G077850|TK1151|cDNA

ATGACCCTTTTGGCCGAAATTAGTCACCAGTGTATATGTAATCGTCTGCTTTGCCTTGTTATACGTCAACTCCACCATCGGCAACACCAGTCCATACAACGCCGTGATCGAATACGGTGTGAATTTCTGTTTCACCAACAGAAACGCGACGCCGGTGAGGACGCCGATCACCGCCGTGATCGAATACAACGCAGGGAGGCGGAAGATTCCGCAGGCGTAGAGAAAGTCGTCGACGCCGGTGTGGACGCCGATCACCGCCG...

CDS

Download CDS FASTA

426 bp · TkA03G077850|TK1151|CDS

ATGACCCTTTTGGCCGAAATTAGTCACCAGTGTATATGTAATCGTCTGCTTTGCCTTGTTATACGTCAACTCCACCATCGGCAACACCAGTCCATACAACGCCGTGATCGAATACGGTGTGAATTTCTGTTTCACCAACAGAAACGCGACGCCGGTGAGGACGCCGATCACCGCCGTGATCGAATACAACGCAGGGAGGCGGAAGATTCCGCAGGCGTAGAGAAAGTCGTCGACGCCGGTGTGGACGCCGATCACCGCCG...

Protein

Download Protein FASTA

141 aa · TkA03G077850|TK1151|PROTEIN

MTLLAEISHQCICNRLLCLVIRQLHHRQHQSIQRRDRIRCEFLFHQQKRDAGEDADHRRDRIQRREAEDSAGVEKVVDAGVDADHRRCKKHPWTHVLDGGSGQKGHMRTILKSLWVNGAQKKLFIGKWGTKKSLRVICEQF

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G077850`
TK1151 ID	TkA03G077850
OH-1004 ID	LXL04_026411
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	88.400
Protein coverage (%)	TK1151 85.816 / OH-1004 23.495 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA03G077850`
Location	Chr03:19862076-19862501 (+)
Description	Similar to CSN5B: COP9 signalosome complex subunit 5b
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_026411` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0000338 protein deneddylation Biological Process GO:0006412 translation Biological Process GO:0006508 proteolysis Biological Process GO:0009585 red, far-red light phototransduction Biological Process GO:0009640 photomorphogenesis Biological Process GO:0009733 response to auxin Biological Process GO:0010093 specification of floral organ identity Biological Process GO:0010100 negative regulation of photomorphogenesis Biological Process GO:0010387 COP9 signalosome assembly Biological Process GO:0010971 positive regulation of G2/M transition of mitotic cell cycle Biological Process GO:0019954 asexual reproduction Biological Process GO:0031347 regulation of defense response Biological Process
KEGG gene cross-reference	ath:AT1G22920 ath:AT1G71230 ddi:DDB_G0284597 dosa:Os04g0654700 hsa:10987 osa:4337249 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.469

Rank 1 · TkA03G077850 · TK1151

Cytoplasm0.423

Rank 2 · TkA03G077850 · TK1151

Mitochondrion0.113

Rank 3 · TkA03G077850 · TK1151

Cell membrane0.065

Rank 4 · TkA03G077850 · TK1151

Extracellular0.057

Rank 5 · TkA03G077850 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF17101Stealth_CR152-67 aa

PF17101Stealth_CR1114-122 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G077850	`PF17101`	Stealth_CR1	52	67	0.2	12.1
TkA03G077850	`PF17101`	Stealth_CR1	114	122	0.2	12.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card