TkA03G030650 | RubberDandelionOmics

Gene overview

TkA03G030650

Reference: TK1151 Chr: Chr03 Coordinates: 8229462-8231369 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

899 bp · TkA03G030650|TK1151|cDNA

TCTGAACACGCCATACACACACAAACACACACCAAGCCAAATTTGATTTCGAAACTCCATCGAATTGATTGTGACAAAGAAGAAACGTGGGATGGCTTATACGCACGATTACCAATCGCTATGACCATCTTCTTCCAACTAGGAAACACCCCCCTTCAATCCAATTGCGCTCAATTTCCGATCAGAAACTAACACAAATTCAGTTCCGGAAAGGGGAGGAGGGAATCGATGGATGAAGAATTGCCAGGGGCAATCGGAAC...

CDS

Download CDS FASTA

468 bp · TkA03G030650|TK1151|CDS

ATGGATGAAGAATTGCCAGGGGCAATCGGAACAAGCGCGAGTTTAGCCCTAAGATTAGGGCAAGCCATATTCTCCGTTGCTTCCCTCCTTTTCATGTGCGTCGGTGTTGAATTCTACGCTTATACGTCTTTCTGTTTTTTGGTGACAATCAAAGGGTTAACAATTCCATGGAGCTTGACTCTCGCAGTGGTGGATGCATTCTCTGTATTTGTAAAACGTCCATCTCACCAAGTACAAATTGTATCCATCATAGTTATAGG...

Protein

Download Protein FASTA

155 aa · TkA03G030650|TK1151|PROTEIN

MDEELPGAIGTSASLALRLGQAIFSVASLLFMCVGVEFYAYTSFCFLVTIKGLTIPWSLTLAVVDAFSVFVKRPSHQVQIVSIIVIGDWVLSFLSLAAACSTASVADFMITEAGAFFCGRKLCSRYQLSAAMAFLSWCLSIASALFNLWLLPSLY

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G030650`
TK1151 ID	TkA03G030650
OH-1004 ID	LXL04_006375
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G030650

Location Chr03:8229462-8231369 (-)

Description Similar to ARALYDRAFT_485429: CASP-like protein ARALYDRAFT_485429

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g49405`	CASP-like protein 5C3.	No verified direct reference in this release
`At4g37235`	CASP-like protein 5C1.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0767900`	CASP-like protein 5C1.	No verified direct reference in this release
`UniProt: B8BPI2`	CASP-like protein 5C1.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_006375 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005886 plasma membrane Cellular Component

GO:0016020 membrane Cellular Component

KEGG gene cross-reference

ath:AT3G50810

ath:AT4G37235

dosa:Os03g0767900

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.772

Rank 1 · TkA03G030650 · TK1151

Cytoplasm0.095

Rank 2 · TkA03G030650 · TK1151

Endoplasmic reticulum0.086

Rank 3 · TkA03G030650 · TK1151

Lysosome / Vacuole0.082

Rank 4 · TkA03G030650 · TK1151

Nucleus0.041

Rank 5 · TkA03G030650 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04535CASP_dom10-139 aa

PF01284MARVEL14-146 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G030650	`PF04535`	CASP_dom	10	139	6.7e-24	85.1
TkA03G030650	`PF01284`	MARVEL	14	146	0.0034	18.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q3ECT8`	Arabidopsis thaliana	sp\|Q3ECT8\|CSPL4_ARATH CASP-like protein 5C3	53.600%	Swiss-Prot	High
`Q66GI1`	Arabidopsis thaliana	sp\|Q66GI1\|CSPLT_ARATH CASP-like protein 5C1	57.800%	Swiss-Prot	High
`Q10EJ2`	Oryza sativa subsp. japonica	sp\|Q10EJ2\|CSPLU_ORYSJ CASP-like protein 5C1	59.200%	Swiss-Prot	High
`B8BPI2`	Oryza sativa subsp. indica	sp\|B8BPI2\|CSPLU_ORYSI CASP-like protein 5C1	58.500%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card