TkA03G020080 | RubberDandelionOmics

Gene overview

TkA03G020080

Reference: TK1151 Chr: Chr03 Coordinates: 5194278-5197454 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1191 bp · TkA03G020080|TK1151|cDNA

ATGACTCGGATAGCTATCCTCTCCGGTTCCAAAAAAAGCTCACTATCCTCTGCACGGATGCTGAGACGATTCCCTTGCACGCCTTCTCTGCACGCATGCTTCTCTGCACGCATGCTTCAAATGGCGCGACGCCTTCTCCGATTTCCCTCTCTATATTTACCAAGATTTGAAATCAGAATTGAAAGGGAGAAATCAGAATTGAAAGGGACTTTCGGTGCCACTACCACCGCACCAAGATTCATTGCTATCGAAGCTGTCTC...

CDS

Download CDS FASTA

1191 bp · TkA03G020080|TK1151|CDS

ATGACTCGGATAGCTATCCTCTCCGGTTCCAAAAAAAGCTCACTATCCTCTGCACGGATGCTGAGACGATTCCCTTGCACGCCTTCTCTGCACGCATGCTTCTCTGCACGCATGCTTCAAATGGCGCGACGCCTTCTCCGATTTCCCTCTCTATATTTACCAAGATTTGAAATCAGAATTGAAAGGGAGAAATCAGAATTGAAAGGGACTTTCGGTGCCACTACCACCGCACCAAGATTCATTGCTATCGAAGCTGTCTC...

Protein

Download Protein FASTA

396 aa · TkA03G020080|TK1151|PROTEIN

MTRIAILSGSKKSSLSSARMLRRFPCTPSLHACFSARMLQMARRLLRFPSLYLPRFEIRIEREKSELKGTFGATTTAPRFIAIEAVSDSSDEVQGMHSDASTLRKASIWREASRIVNEEGFRAFWKGNLVTIAHRLPYSSISFYAFERYKNVVTTNISADLCIRLAVVDAKIVTCSRDGSAIIWTPKSRKSHVPIDMFQVVFAGYSAESLLQRIMDCKPKIVVTCNAVKRGKKVLNLKGYFRFFKYKDRRVPPPNAVRIP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G020080`
TK1151 ID	TkA03G020080
OH-1004 ID	LXL04_020358
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	73.900
Protein coverage (%)	TK1151 94.949 / OH-1004 99.746 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G020080

Location Chr03:5194278-5197454 (+)

Description Similar to ACS: Acetyl-coenzyme A synthetase, chloroplastic/glyoxysomal

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g36880`	Catalyzes the production of acetyl-CoA, an activated form of acetate that can be used for lipid synthesis or for energy generation.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_020358 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006083 acetate metabolic process Biological Process

GO:0006085 acetyl-CoA biosynthetic process Biological Process

GO:0006631 fatty acid metabolic process Biological Process

GO:0019427 acetyl-CoA biosynthetic process from acetate Biological Process

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009514 glyoxysome Cellular Component

GO:0009536 plastid Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0003987 acetate-CoA ligase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0016208 AMP binding Molecular Function

KEGG gene cross-reference

ath:AT5G36880

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.317

Rank 1 · TkA03G020080 · TK1151

Nucleus0.217

Rank 2 · TkA03G020080 · TK1151

Cytoplasm0.196

Rank 3 · TkA03G020080 · TK1151

Plastid0.163

Rank 4 · TkA03G020080 · TK1151

Cell membrane0.098

Rank 5 · TkA03G020080 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00153Mito_carr102-155 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G020080	`PF00153`	Mito_carr	102	155	5.2e-10	39.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`B9DGD6`	Arabidopsis thaliana	sp\|B9DGD6\|ACS_ARATH Acetyl-coenzyme A synthetase, chloroplastic/glyoxysomal	71.800%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card