TkA02G591900 | RubberDandelionOmics

Gene overview

TkA02G591900

Reference: TK1151 Chr: Chr02 Coordinates: 152710729-152711307 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

579 bp · TkA02G591900|TK1151|cDNA

ATGGAACTCAAATTTCTCATGATACTATTTCTTGCCACACTTCTATTGGCTCCAGTTTCATCTGCCAGTGTTGCTCAACAAAACACATACTCTACATTCGTCAAAACCTCATGCAGCTCCGTCACTTACTCCGCCGTCTGCCTGAAAACCCTCCTCCCCTACGCCTCCGCCGTCAAGACCAACCCCCTTAAACTGGTCAACGTCGCCCTGTACACCACCCTCAGATCCGCCAACGCCACCCTCATCACCGTCACCAACTT...

CDS

Download CDS FASTA

579 bp · TkA02G591900|TK1151|CDS

ATGGAACTCAAATTTCTCATGATACTATTTCTTGCCACACTTCTATTGGCTCCAGTTTCATCTGCCAGTGTTGCTCAACAAAACACATACTCTACATTCGTCAAAACCTCATGCAGCTCCGTCACTTACTCCGCCGTCTGCCTGAAAACCCTCCTCCCCTACGCCTCCGCCGTCAAGACCAACCCCCTTAAACTGGTCAACGTCGCCCTGTACACCACCCTCAGATCCGCCAACGCCACCCTCATCACCGTCACCAACTT...

Protein

Download Protein FASTA

192 aa · TkA02G591900|TK1151|PROTEIN

MELKFLMILFLATLLLAPVSSASVAQQNTYSTFVKTSCSSVTYSAVCLKTLLPYASAVKTNPLKLVNVALYTTLRSANATLITVTNLSKSKQITKWESAILKDCIGHIKDSMDEIKDSIKAISRLPKSADKRFVISNAQTWTSAAITNENSCLDGFADGKISSTIKKKIKNSVVSLARVSSNALYLINNLTV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G591900`
TK1151 ID	TkA02G591900
OH-1004 ID	LXL04_012029
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G591900

Location Chr02:152710729-152711307 (+)

Description Similar to PMEI4: Pectinesterase inhibitor 4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g47380`	Pectin methylesterase (PME) inhibitor involved in the maintenance of cell wall integrity in response to necrotrophic pathogens.	No verified direct reference in this release
`At1g62760`	Pectin methylesterase (PME) inhibitor involved in the maintenance of cell wall integrity in response to necrotrophic pathogens.	No verified direct reference in this release
`At4g25260`	Pectin methylesterase (PME) inhibitor that can target PME3 in a pH-dependent manner, mainly in slightly acidic conditions (pH 6.0 and 5.0) but not at pH 7.0.	Tuning of Pectin Methylesterification: PECTIN METHYLESTERASE INHIBITOR 7 MODULATES THE PROCESSIVE ACTIVITY OF CO-EXPRESSED PECTIN METHYLESTERASE 3 IN A pH-DEPENDENT MANNER.2015 · DOI: 10.1074/jbc.m115.639534 Structural and dynamical characterization of the pH-dependence of the pectin methylesterase-pectin methylesterase inhibitor complex.2017 · DOI: 10.1074/jbc.ra117.000197
`At1g62770`	Pectin methylesterase (PME) inhibitor that probably targets root-expressed PME and PME3 in a moderate pH-dependent manner, mainly in slightly acidic conditions (pH 6.3 and 5.0) and to some extent at pH 7.5.	Combined Experimental and Computational Approaches Reveal Distinct pH Dependence of Pectin Methylesterase Inhibitors.2017 · DOI: 10.1104/pp.16.01790

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_012029 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009641 shade avoidance Biological Process

GO:0009827 plant-type cell wall modification Biological Process

GO:0071669 plant-type cell wall organization or biogenesis Biological Process

GO:2000280 regulation of root development Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0048046 apoplast Cellular Component

GO:0004857 enzyme inhibitor activity Molecular Function

GO:0046910 pectinesterase inhibitor activity Molecular Function

KEGG gene cross-reference

ath:AT1G62760

ath:AT3G47380

ath:AT4G25250

ath:AT4G25260

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.563

Rank 1 · TkA02G591900 · TK1151

Endoplasmic reticulum0.181

Rank 2 · TkA02G591900 · TK1151

Cytoplasm0.120

Rank 3 · TkA02G591900 · TK1151

Cell membrane0.089

Rank 4 · TkA02G591900 · TK1151

Lysosome / Vacuole0.071

Rank 5 · TkA02G591900 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07359LEAP-22-30 aa

PF25642DUF794428-36 aa

PF04043PMEI33-186 aa

PF13344Hydrolase_671-92 aa

PF09177STX6_10_61_N85-136 aa

PF13344Hydrolase_6101-149 aa

PF25642DUF7944107-151 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G591900	`PF07359`	LEAP-2	2	30	0.1	13.2
TkA02G591900	`PF25642`	DUF7944	28	36	0.085	14.2
TkA02G591900	`PF04043`	PMEI	33	186	5.8e-30	105.2
TkA02G591900	`PF13344`	Hydrolase_6	71	92	0.042	14.6
TkA02G591900	`PF09177`	STX6_10_61_N	85	136	0.2	12.9
TkA02G591900	`PF13344`	Hydrolase_6	101	149	0.042	14.6
TkA02G591900	`PF25642`	DUF7944	107	151	0.085	14.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9STY5`	Arabidopsis thaliana	sp\|Q9STY5\|PMI11_ARATH Pectinesterase inhibitor 11	39.400%	Swiss-Prot	Medium
`Q9SI74`	Arabidopsis thaliana	sp\|Q9SI74\|PMI10_ARATH Pectinesterase inhibitor 10	38.000%	Swiss-Prot	Medium
`Q9SB37`	Arabidopsis thaliana	sp\|Q9SB37\|PMEI7_ARATH Pectinesterase inhibitor 7	34.000%	Swiss-Prot	Medium
`Q9SI72`	Arabidopsis thaliana	sp\|Q9SI72\|PMEI9_ARATH Pectinesterase inhibitor 9	35.700%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card