TkA02G588530 | RubberDandelionOmics

Gene overview

TkA02G588530

Reference: TK1151 Chr: Chr02 Coordinates: 151888105-151890123 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1273 bp · TkA02G588530|TK1151|cDNA

GATACGTACGCAAAACGATCAAACCAACAATTTAAAGAACTTTTCAACATAATTAGACCATGATTTAGAATTAACGTTCACTGTCGATGATTATGAAGCTGGCCAAAATTAGCACCGGTCATAATTATTCGCTGCAAAACTATTTAATCCCAACGTTAATTCCGTTGAGAAATCCACCGGCAACCCCATTCCACATCTCACCGACCGGCTAAACAGACCGTAGGAATCCTTCGGACTGCTCGGCCGATGGTGATTTAGGA...

CDS

Download CDS FASTA

681 bp · TkA02G588530|TK1151|CDS

ATGGTGTTCCTCAGATATGCCCTGTTCTTGTGTCTTGTTTCAATGGCTTTCTGTCAAGAAAGCATGGACGTCGAGTTTAACCTCCTTCCAAGACCTTTGATCATTGAATACCCGGAAACCCGACTCAGTAACATTACGGAAGAGCTTAAAATGCAATGCACGAGTTGGAGAGTCGCCGGGGAATCGAACAATTTGGCCCCCTGGAAAACGATTCCGACAGAATGTGCGGAGTATGTAGAAGAATATATGCTGGGTCGGGC...

Protein

Download Protein FASTA

226 aa · TkA02G588530|TK1151|PROTEIN

MVFLRYALFLCLVSMAFCQESMDVEFNLLPRPLIIEYPETRLSNITEELKMQCTSWRVAGESNNLAPWKTIPTECAEYVEEYMLGRAYNFDLETVSKEARLYAKTLKLGDDGMDAWVFDIDETLLSNLPYYSDHGFGLEVFDCAQFDRWVLEGVAPVIRPSLKLYKDVIGLGIKIILLTGRSEDKRNVTISNLMDAGYLKWDKLILRGEEDEGKSAAAFKSEKRKR

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G588530`
TK1151 ID	TkA02G588530
OH-1004 ID	LXL04_012079
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 99.558 / OH-1004 84.906 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G588530

Location Chr02:151888105-151890123 (+)

Description Similar to APS1: Acid phosphatase 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g24770`	May function as somatic storage protein during early seedling development.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_012079 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0002213 defense response to insect Biological Process

GO:0006952 defense response Biological Process

GO:0006979 response to oxidative stress Biological Process

GO:0009611 response to wounding Biological Process

GO:0009625 response to insect Biological Process

GO:0009753 response to jasmonic acid Biological Process

GO:0046688 response to copper ion Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0022626 cytosolic ribosome Cellular Component

GO:0003993 acid phosphatase activity Molecular Function

GO:0045735 nutrient reservoir activity Molecular Function

KEGG gene cross-reference

ath:AT5G24770

gmx:547820

gmx:547821

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.402

Rank 1 · TkA02G588530 · TK1151

Endoplasmic reticulum0.192

Rank 2 · TkA02G588530 · TK1151

Golgi apparatus0.179

Rank 3 · TkA02G588530 · TK1151

Extracellular0.172

Rank 4 · TkA02G588530 · TK1151

Cytoplasm0.147

Rank 5 · TkA02G588530 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03767Acid_phosphat_B43-225 aa

PF10307HAD_SAK_1176-221 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G588530	`PF03767`	Acid_phosphat_B	43	225	4.1e-61	207.1
TkA02G588530	`PF10307`	HAD_SAK_1	176	221	0.034	14.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O82122`	Arabidopsis thaliana	sp\|O82122\|VSP2_ARATH Vegetative storage protein 2	37.200%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card