TkA02G584860 | RubberDandelionOmics

Gene overview

TkA02G584860

Reference: TK1151 Chr: Chr02 Coordinates: 150893366-150897334 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2244 bp · TkA02G584860|TK1151|cDNA

CACGTTCGAAATTAATTTTACTGGAATTAATTACAAGCAACTTTCTATCGACAGAAAAAGGATGAATCTCAGCCGTTAACCAAACGAATATTTTTAGCCAAAAAAATCTTACATATATTACACGGTGCGCCAAGTTCAGTGGTATGGTGGCGGAGCACAGTCACTGAACTCGCTTAGCCCATTTCTCAACAATGAAAACCACCGAACCCTTTAGCGACGTTGAGAATGCACCCAACAGCACTCCGCTACTAAACCACCCT...

CDS

Download CDS FASTA

1860 bp · TkA02G584860|TK1151|CDS

ATGAAAACCACCGAACCCTTTAGCGACGTTGAGAATGCACCCAACAGCACTCCGCTACTAAACCACCCTGAACCCCCGCGAGCCGCCGTGAGAAAACAGTCGTTTGTCAGGGTGCTATCAAGTATCACTTTGGTTTCTCTGTTCTTCGTTTTAGCGTTCGTACTCATCGTCTTGAACCAACAAGATTCCACGACCACTGTTGCTAATTCAGCACCGCCGGGAGCTACAGTGCCGGAGAAATCCTCCGTAAAGCACTCCCA...

Protein

Download Protein FASTA

619 aa · TkA02G584860|TK1151|PROTEIN

MKTTEPFSDVENAPNSTPLLNHPEPPRAAVRKQSFVRVLSSITLVSLFFVLAFVLIVLNQQDSTTTVANSAPPGATVPEKSSVKHSQSDRLRWERTAYHFQPAKNFIYGPLFHMGWYHLFYQYNPYAPIWGNMSWGHAVSKDMIHWFELPVAIVPTEWYDIEGVLSGSTTALPNGQIFALYTGNAKDFSQLQCKAVPLNASDPLLVEWVKYEDNPILYIPPGIGPKDYRDPSTVWTGPDGKHRMIMGTKQNGTGMVHVYH...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G584860`
TK1151 ID	TkA02G584860
OH-1004 ID	LXL04_012161
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.600
Protein coverage (%)	TK1151 82.876 / OH-1004 93.273 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA02G584860`
Location	Chr02:150893366-150897334 (+)
Description	Similar to INV*DC4: Beta-fructofuranosidase, soluble isoenzyme I
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_012161` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0005975 carbohydrate metabolic process Biological Process GO:0005985 sucrose metabolic process Biological Process GO:0005774 vacuolar membrane Cellular Component GO:0005775 vacuolar lumen Cellular Component GO:0016020 membrane Cellular Component GO:0004564 beta-fructofuranosidase activity Molecular Function
KEGG gene cross-reference	cann:107863437 sly:543992 vra:106768621 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.475

Rank 1 · TkA02G584860 · TK1151

Endoplasmic reticulum0.198

Rank 2 · TkA02G584860 · TK1151

Cytoplasm0.155

Rank 3 · TkA02G584860 · TK1151

Golgi apparatus0.127

Rank 4 · TkA02G584860 · TK1151

Extracellular0.110

Rank 5 · TkA02G584860 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00251Glyco_hydro_32N99-414 aa

PF10082BBP2_2311-355 aa

PF08244Glyco_hydro_32C417-608 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G584860	`PF00251`	Glyco_hydro_32N	99	414	1.6e-78	265.1
TkA02G584860	`PF10082`	BBP2_2	311	355	0.07	12.7
TkA02G584860	`PF08244`	Glyco_hydro_32C	417	608	2.9e-19	70.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card