TkA02G574900 | RubberDandelionOmics

Gene overview

TkA02G574900

Reference: TK1151 Chr: Chr02 Coordinates: 148415732-148418835 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

759 bp · TkA02G574900|TK1151|cDNA

ATGCTTTTATCTTCCTCCAGATCTTCTAGTGGTTTTTCTATTTGGCGCGAACTTCAAACTCCACAGTGTGACGCCGTCGGATCTACTGCCGTCGTTGCGGTAGTGACTCCCGAGAAGATCGTCGTTTCCGACTGTGGATATTCGCGTGTAGAGCTTTGCAGGAACGGCGTCGCTATTCCTTTCTCCGTAGGTCATAAGGATAGGCTTACGTTAGAGTTTGTACATGATTTGTTACGACCCGGGTTGGACCAACTCCGAAG...

CDS

Download CDS FASTA

759 bp · TkA02G574900|TK1151|CDS

ATGCTTTTATCTTCCTCCAGATCTTCTAGTGGTTTTTCTATTTGGCGCGAACTTCAAACTCCACAGTGTGACGCCGTCGGATCTACTGCCGTCGTTGCGGTAGTGACTCCCGAGAAGATCGTCGTTTCCGACTGTGGATATTCGCGTGTAGAGCTTTGCAGGAACGGCGTCGCTATTCCTTTCTCCGTAGGTCATAAGGATAGGCTTACGTTAGAGTTTGTACATGATTTGTTACGACCCGGGTTGGACCAACTCCGAAG...

Protein

Download Protein FASTA

252 aa · TkA02G574900|TK1151|PROTEIN

MLLSSSRSSSGFSIWRELQTPQCDAVGSTAVVAVVTPEKIVVSDCGYSRVELCRNGVAIPFSVGHKDRLTLEFVHDLLRPGLDQLRRPGILRFESHQQPASTVLSKAIWLGCIGLLDLTMPGLWSWSNPGRNKKSALFCYDPGWTNSEGPASVMSQVRVSPTTCLRGIVQGDMVGVYWAARPYDAGPSELVTFLLRPGLDQLRRPGIVRVRSQVRVSPTTCLRGIVQGDMVGVYWAARPYDAGPSELVQPGS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G574900`
TK1151 ID	TkA02G574900
OH-1004 ID	LXL04_003769
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	58.800
Protein coverage (%)	TK1151 64.683 / OH-1004 57.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G574900

Location Chr02:148415732-148418835 (+)

Description Protein of unknown function

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g11410`	Major negative regulator of abscisic acid (ABA) responses during seed germination and cold acclimation.	Antisense inhibition of protein phosphatase 2C accelerates cold acclimation in Arabidopsis thaliana.2001 · DOI: 10.1046/j.1365-313x.2001.01048.x Physical and functional interaction of the Arabidopsis K(+) channel AKT2 and phosphatase AtPP2CA.2002 · DOI: 10.1105/tpc.000943 ABA-hypersensitive germination3 encodes a protein phosphatase 2C (AtPP2CA) that strongly regulates abscisic acid signaling during germination among Arabidopsis protein phosphatase 2Cs.2006 · DOI: 10.1104/pp.105.070128 The protein phosphatase AtPP2CA negatively regulates abscisic acid signal transduction in Arabidopsis, and effects of abh1 on AtPP2CA mRNA.2006 · DOI: 10.1104/pp.105.070318 ABA-Hypersensitive Germination1 encodes a protein phosphatase 2C, an essential component of abscisic acid signaling in Arabidopsis seed.2007 · DOI: 10.1111/j.1365-313x.2007.03107.x ABI1 and PP2CA phosphatases are negative regulators of Snf1-related protein kinase1 signaling in Arabidopsis.2013 · DOI: 10.1105/tpc.113.114066
`At1g07430`	Involved in the negative regulation of the K(+) potassium channel AKT1 by its dephosphorylation, antagonistically to CIPK proteins (e.g. CIPK23).	No verified direct reference in this release
`At2g29380`	Probable protein phosphatase 2C 24.	No verified direct reference in this release
`At5g59220`	Acts as a negative regulator of abscisic acid (ABA) signaling for stomatal closure in leaves, and controls water loss during leaf senescence.	An ABA-regulated and Golgi-localized protein phosphatase controls water loss during leaf senescence in Arabidopsis.2012 · DOI: 10.1111/j.1365-313x.2011.04821.x An abscisic acid-AtNAP transcription factor-SAG113 protein phosphatase 2C regulatory chain for controlling dehydration in senescing Arabidopsis leaves.2012 · DOI: 10.1104/pp.111.190876 Selective inhibition of clade A phosphatases type 2C by PYR/PYL/RCAR abscisic acid receptors.2012 · DOI: 10.1104/pp.111.188623 Unique drought resistance functions of the highly ABA-induced clade A protein phosphatase 2Cs.2012 · DOI: 10.1104/pp.112.202408

Rice

Reference gene ID	Possible function	Papers / DOI
`Os05g0457200`	Probable protein phosphatase 2C 49.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_003769 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source) No functional description available

KEGG gene cross-reference No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.525

Rank 1 · TkA02G574900 · TK1151

Nucleus0.331

Rank 2 · TkA02G574900 · TK1151

Mitochondrion0.137

Rank 3 · TkA02G574900 · TK1151

Cell membrane0.093

Rank 4 · TkA02G574900 · TK1151

Endoplasmic reticulum0.083

Rank 5 · TkA02G574900 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00481PP2C20-71 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G574900	`PF00481`	PP2C	20	71	3.4e-07	30.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P49598`	Arabidopsis thaliana	sp\|P49598\|P2C37_ARATH Protein phosphatase 2C 37	82.000%	Swiss-Prot	Low
`Q9LNW3`	Arabidopsis thaliana	sp\|Q9LNW3\|P2C03_ARATH Protein phosphatase 2C 3	72.000%	Swiss-Prot	Low
`Q9ZW21`	Arabidopsis thaliana	sp\|Q9ZW21\|P2C24_ARATH Probable protein phosphatase 2C 24	66.000%	Swiss-Prot	Low
`Q9FIF5`	Arabidopsis thaliana	sp\|Q9FIF5\|P2C78_ARATH Probable protein phosphatase 2C 78	70.000%	Swiss-Prot	Low
`Q65XG6`	Oryza sativa subsp. japonica	sp\|Q65XG6\|P2C49_ORYSJ Probable protein phosphatase 2C 49	64.700%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card