Gene Card
Gene overview
cDNA / CDS / Protein Sequences
543 bp · TkA02G561100|TK1151|cDNA
ATGAAAAAAATATATGAATCTGGGTATCAAAAACGTAAGAAAAAACAAAAACTTGAAGCATTAAATCAATCTCAAAAAGGGGCTATGGATAAGTTTGTAATAAAACCAACACCAACCTCTCAAGAGAATGACAATGAAGCAAATGCTAATAATGTTGATGATTCTAATGTTGTTGATGTTAATGTTGATAATATTGATGGTAATGATAATTTGGATGACAATGCTAATGCTAATTTGGATGATAATAATAATGCTAATGA...
543 bp · TkA02G561100|TK1151|CDS
ATGAAAAAAATATATGAATCTGGGTATCAAAAACGTAAGAAAAAACAAAAACTTGAAGCATTAAATCAATCTCAAAAAGGGGCTATGGATAAGTTTGTAATAAAACCAACACCAACCTCTCAAGAGAATGACAATGAAGCAAATGCTAATAATGTTGATGATTCTAATGTTGTTGATGTTAATGTTGATAATATTGATGGTAATGATAATTTGGATGACAATGCTAATGCTAATTTGGATGATAATAATAATGCTAATGA...
Protein
Download Protein FASTA180 aa · TkA02G561100|TK1151|PROTEIN
MKKIYESGYQKRKKKQKLEALNQSQKGAMDKFVIKPTPTSQENDNEANANNVDDSNVVDVNVDNIDGNDNLDDNANANLDDNNNANDNAFHTFDIFDPRNWDSLDSNMINILALKGPKRDLSIIKGPKDKNFRRFSSAYFTRTLPNGENVIGIGLFILKKWIKYFVFVVNYFVKGVEKVY
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA02G561100 |
|---|---|
| TK1151 ID | TkA02G561100 |
| OH-1004 ID | LXL04_024284 |
| Relationship / confidence | Non Reciprocal Best Hit / Complex relationship |
| Protein identity (%) | 62.800 |
| Protein coverage (%) | TK1151 47.778 / OH-1004 29.452Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA02G561100 |
|---|---|
| Location | Chr02:144911184-144911785 (+) |
| Description | Similar to ABCB1: ABC transporter B family member 1 |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0000122 negative regulation of transcription by RNA polymerase II Biological Process GO:0006351 DNA-templated transcription Biological Process GO:0008361 regulation of cell size Biological Process GO:0009555 pollen development Biological Process GO:0009624 response to nematode Biological Process GO:0009637 response to blue light Biological Process GO:0009639 response to red or far red light Biological Process GO:0009640 photomorphogenesis Biological Process GO:0009733 response to auxin Biological Process GO:0009734 auxin-activated signaling pathway Biological Process GO:0009741 response to brassinosteroid Biological Process GO:0009742 brassinosteroid mediated signaling pathway Biological Process |
| KEGG gene cross-reference | ath:AT2G36910 hsa:9205 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF30301MPSS2_M11-93 aaPF21063Reovirus_L2_GTase69-137 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA02G561100 | PF30301 | MPSS2_M | 11 | 93 | 8.5 | 5.6 |
| TkA02G561100 | PF21063 | Reovirus_L2_GTase | 69 | 137 | 0.083 | 12.9 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.