RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA02G553340
Reference: TK1151 Chr: Chr02 Coordinates: 142797041-142799727 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

1841 bp · TkA02G553340|TK1151|cDNA

ATATCTTATCATGAGGGCGACCGCTTCCTAAACAAAACTTAGCTACATACTGTACTTTTTCTTCTCTCTCTCATTTGTTCGTTGTTATCTAAGTTCGCAAAATCTCCATCTCTCTAGACTTTCTCTCTATATATCTATATCTCAACTCATATACATACAGATAAATAGATAAATGTATATACACGCGGTGCTAGAGAAATCAAAACCCTAGAAGACATCCGACTGCGATCGGAGAAAGTTGGAATCGAAATCGATGATCG...

CDS

Download CDS FASTA

1203 bp · TkA02G553340|TK1151|CDS

ATGTATAAGAACCAGCTGCAGGAGCTGGCGCAGAGGAGCTGCTTTAATTTGCCGTCGTACATAAGTATCCGAGAAGGTCCAGATCACGCGCCGCGGTTCAAGGCCACGGTTAACTTTAATGGCGAAACGTATGAGAGCCCTAACTACTGCACGACGTTGAGGCAAGCGGAGCACTCGGCCGCTGAGGTTGCTTTGAATGCACTCGCTAGCCGTGGTCCGTCTAATTCTTTGGCTGCTCGAATACTGGACGAGACTGGGGT...

Protein

Download Protein FASTA

400 aa · TkA02G553340|TK1151|PROTEIN

MYKNQLQELAQRSCFNLPSYISIREGPDHAPRFKATVNFNGETYESPNYCTTLRQAEHSAAEVALNALASRGPSNSLAARILDETGVYKNLLQEVSQRVGASLPTYTTFRSGLGHLPVFTCTVELAGCTFTGEPAKNKKQAEKNAAMSAWSSLKLLTQQTESSSLQKGMLEEQEHVIVARALQKFRLKARMSNIPFPIQFPPPNPKPNTLQSPPSTTSKILPFICPKTTPRNRPHLTTLLDTDELSNKNRNEKPPPSPPP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA02G553340
TK1151 IDTkA02G553340
OH-1004 IDLXL04_012557
Relationship / confidenceRbh High Identity Coverage Synteny / Strict
Protein identity (%)100.000
Protein coverage (%)TK1151 100.000 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA02G553340
LocationChr02:142797041-142799727 (-)
DescriptionSimilar to DRB2: Double-stranded RNA-binding protein 2
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At2g28380 Binds double-stranded RNA.
Specific interactions between Dicer-like proteins and HYL1/DRB-family dsRNA-binding proteins in Arabidopsis thaliana.2005 · DOI: 10.1007/s11103-004-6853-5
At3g26932 Binds double-stranded RNA. No verified direct reference in this release
At5g41070 Binds double-stranded RNA.
Specific interactions between Dicer-like proteins and HYL1/DRB-family dsRNA-binding proteins in Arabidopsis thaliana.2005 · DOI: 10.1007/s11103-004-6853-5

Rice

Reference gene IDPossible functionPapers / DOI
Os10g0480500 Binds double-stranded RNA. No verified direct reference in this release
Os05g0150400 Binds double-stranded RNA. No verified direct reference in this release
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_012557 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0035196 miRNA processing Biological Process
GO:0005634 nucleus Cellular Component
GO:0005737 cytoplasm Cellular Component
GO:0009507 chloroplast Cellular Component
GO:0003725 double-stranded RNA binding Molecular Function
KEGG gene cross-reference
ath:AT2G28380
ath:AT3G26932
ath:AT5G41070
dosa:Os05g0150400
dosa:Os10g0480500
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.769
Rank 1 · TkA02G553340 · TK1151
Cytoplasm0.313
Rank 2 · TkA02G553340 · TK1151
Cell membrane0.042
Rank 3 · TkA02G553340 · TK1151
Endoplasmic reticulum0.041
Rank 4 · TkA02G553340 · TK1151
Mitochondrion0.015
Rank 5 · TkA02G553340 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00035dsrm2-68 aa
PF14709DND1_DSRM4-68 aa
PF16857RNA_pol_inhib32-60 aa
PF03368Dicer_dimer42-71 aa
PF00035dsrm88-153 aa
PF03368Dicer_dimer116-153 aa
PF14709DND1_DSRM127-153 aa
PF16857RNA_pol_inhib335-339 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA02G553340PF00035dsrm2682.5e-31108.8
TkA02G553340PF14709DND1_DSRM4680.008117.2
TkA02G553340PF16857RNA_pol_inhib32600.1412.9
TkA02G553340PF03368Dicer_dimer42710.01915.7
TkA02G553340PF00035dsrm881532.5e-31108.8
TkA02G553340PF03368Dicer_dimer1161530.01915.7
TkA02G553340PF14709DND1_DSRM1271530.008117.2
TkA02G553340PF16857RNA_pol_inhib3353390.1412.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9SKN2Arabidopsis thalianasp|Q9SKN2|DRB2_ARATH Double-stranded RNA-binding protein 261.500%Swiss-ProtHigh
Q9LJF5Arabidopsis thalianasp|Q9LJF5|DRB3_ARATH Double-stranded RNA-binding protein 368.100%Swiss-ProtLow
Q8GY79Arabidopsis thalianasp|Q8GY79|DRB5_ARATH Double-stranded RNA-binding protein 569.700%Swiss-ProtLow
Q9AV50Oryza sativa subsp. japonicasp|Q9AV50|DRB6_ORYSJ Double-stranded RNA-binding protein 661.800%Swiss-ProtHigh
Q0DKP4Oryza sativa subsp. japonicasp|Q0DKP4|DRB2_ORYSJ Double-stranded RNA-binding protein 276.800%Swiss-ProtLow

JBrowse

View in Genome Browser