TkA02G551040 | RubberDandelionOmics

Gene overview

TkA02G551040

Reference: TK1151 Chr: Chr02 Coordinates: 142185219-142185584 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

366 bp · TkA02G551040|TK1151|cDNA

ATGGCGCCTAAGAGAAGTTTGGGTCGGCAAAAGATTAAAATCGCTCAAATCCAGAAAAAATCCGATCTCCAAGTAACTTTCTCAAAAAGACGGGTAGGGCTCTTTAAGAAAGCTAGCGAGCTTTGCACATTGTGTGGGGTTGAGATCGCCATTATCGTCTTTTCTCCAGCTCGGAAAGTTTACTCCTTCGGCCACCCTAAAGTTGAGTCAATTGTTGATAGACTCCTGACTCGGAACCCAAATCTAAACTCTACAAATTT...

CDS

Download CDS FASTA

366 bp · TkA02G551040|TK1151|CDS

ATGGCGCCTAAGAGAAGTTTGGGTCGGCAAAAGATTAAAATCGCTCAAATCCAGAAAAAATCCGATCTCCAAGTAACTTTCTCAAAAAGACGGGTAGGGCTCTTTAAGAAAGCTAGCGAGCTTTGCACATTGTGTGGGGTTGAGATCGCCATTATCGTCTTTTCTCCAGCTCGGAAAGTTTACTCCTTCGGCCACCCTAAAGTTGAGTCAATTGTTGATAGACTCCTGACTCGGAACCCAAATCTAAACTCTACAAATTT...

Protein

Download Protein FASTA

121 aa · TkA02G551040|TK1151|PROTEIN

MAPKRSLGRQKIKIAQIQKKSDLQVTFSKRRVGLFKKASELCTLCGVEIAIIVFSPARKVYSFGHPKVESIVDRLLTRNPNLNSTNLHLVEAHMIASIPDLNVQQTHMCDELEAEKKEAKP

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G551040`
TK1151 ID	TkA02G551040
OH-1004 ID	LXL04_012596
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.100
Protein coverage (%)	TK1151 96.694 / OH-1004 22.807 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G551040

Location Chr02:142185219-142185584 (+)

Description Similar to AGL62: Agamous-like MADS-box protein AGL62

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g24840`	Probable transcription factor.	AGL61 interacts with AGL80 and is required for central cell development in Arabidopsis.2008 · DOI: 10.1104/pp.108.119404 The MADS domain protein DIANA acts together with AGAMOUS-LIKE80 to specify the central cell in Arabidopsis ovules.2008 · DOI: 10.1105/tpc.108.058958
`At5g60440`	Probable transcription factor.	The AGL62 MADS domain protein regulates cellularization during endosperm development in Arabidopsis.2008 · DOI: 10.1105/tpc.107.055137
`At1g01530`	Probable transcription factor that may function as a floral promoter operating upstream of known floral activators in the autonomous pathway.	Overexpression of AGAMOUS-LIKE 28 (AGL28) promotes flowering by upregulating expression of floral promoters within the autonomous pathway.2006 · DOI: 10.1016/j.bbrc.2006.07.121
`At1g65360`	Probable transcription factor that controls female gametophyte (megagametogenesis) development and chloroplast biogenesis during embryo development.	AGL23, a type I MADS-box gene that controls female gametophyte and embryo development in Arabidopsis.2008 · DOI: 10.1111/j.1365-313x.2008.03485.x
`At2g34440`	Probable transcription factor.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_012596 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006357 regulation of transcription by RNA polymerase II Biological Process

GO:0009559 embryo sac central cell differentiation Biological Process

GO:0009911 positive regulation of flower development Biological Process

GO:0009960 endosperm development Biological Process

GO:0045944 positive regulation of transcription by RNA polymerase II Biological Process

GO:2000012 regulation of auxin polar transport Biological Process

GO:0005634 nucleus Cellular Component

GO:0043078 polar nucleus Cellular Component

GO:0000978 RNA polymerase II cis-regulatory region sequence-specific DNA binding Molecular Function

GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

KEGG gene cross-reference

ath:AT1G01530

ath:AT2G24840

ath:AT5G60440

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.891

Rank 1 · TkA02G551040 · TK1151

Cytoplasm0.169

Rank 2 · TkA02G551040 · TK1151

Endoplasmic reticulum0.019

Rank 3 · TkA02G551040 · TK1151

Cell membrane0.018

Rank 4 · TkA02G551040 · TK1151

Plastid0.014

Rank 5 · TkA02G551040 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00319SRF-TF17-63 aa

PF15094DUF455618-40 aa

PF20876VipE64-108 aa

PF15094DUF455693-113 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G551040	`PF00319`	SRF-TF	17	63	8.7e-25	86.6
TkA02G551040	`PF15094`	DUF4556	18	40	0.071	13.9
TkA02G551040	`PF20876`	VipE	64	108	0.0095	16.6
TkA02G551040	`PF15094`	DUF4556	93	113	0.071	13.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q4PSU4`	Arabidopsis thaliana	sp\|Q4PSU4\|AGL61_ARATH Agamous-like MADS-box protein AGL61	56.800%	Swiss-Prot	High
`Q9FKK2`	Arabidopsis thaliana	sp\|Q9FKK2\|AGL62_ARATH Agamous-like MADS-box protein AGL62	55.200%	Swiss-Prot	High
`Q9LMM8`	Arabidopsis thaliana	sp\|Q9LMM8\|AGL28_ARATH Agamous-like MADS-box protein AGL28	51.800%	Swiss-Prot	High
`O80807`	Arabidopsis thaliana	sp\|O80807\|AGL23_ARATH Agamous-like MADS-box protein AGL23	58.300%	Swiss-Prot	Medium
`O64703`	Arabidopsis thaliana	sp\|O64703\|AGL29_ARATH Agamous-like MADS-box protein AGL29	54.300%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card