TkA02G547650 | RubberDandelionOmics

Gene overview

TkA02G547650

Reference: TK1151 Chr: Chr02 Coordinates: 141332284-141335022 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1460 bp · TkA02G547650|TK1151|cDNA

GCGAAAACTACCGAAGACAAAGACGTACAATAGATGTTGCACAACGTATCAAAACCACAGCACAAACGTAGCACGCCGGTGTTATAGACATCACAATCCCTTTTACATATATTTGTTCACCGGCGACATCACGAGGGTACCATCGGTGGCCACGGCGATCGACGACGTATTAGGGCAACCGTACCGCCAGATCCACGACGGATTGACGCAAAATCATCACCATGTCGCGAGAAAGATTTAGAAAAGCTCTATTGCCTCCT...

CDS

Download CDS FASTA

969 bp · TkA02G547650|TK1151|CDS

ATGTCGCGAGAAAGATTTAGAAAAGCTCTATTGCCTCCTGGAGCTGAGAATATTGAGAAGTTAAAGAACATTGTAAAAGAAGGGAATTACTATGGGGCTCAACAGATGTACAAGACCATTAGTGCAAGATATGCTACAGTCGGACGATACTCTGAAGCCTTAGAACTTCTTCAGTCAGGTGCATGTCTCCAATTAGAACACGATCAGGTAACGTGTGGAGGTGAGCTTGCTGTGTTGTTTGTGGAGATGCTAGTCAAAGC...

Protein

Download Protein FASTA

322 aa · TkA02G547650|TK1151|PROTEIN

MSRERFRKALLPPGAENIEKLKNIVKEGNYYGAQQMYKTISARYATVGRYSEALELLQSGACLQLEHDQVTCGGELAVLFVEMLVKAKVDFDDDYLDRIRKIYKKFPRIPLPQNLGLEDDEEIHRLSETLGAAKTRVESCTSFLKAAIKWSSDTGPRKLGSAELHDMLAEYIYSESPEADMARVSLHFARGRNPKKFASTLVNFMGKCYPGEDDLAIARAVLMYLSTGNLRDANNIMDEIKKLAWAKELEFPESELMRFI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G547650`
TK1151 ID	TkA02G547650
OH-1004 ID	LXL04_012641
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G547650

Location Chr02:141332284-141335022 (+)

Description Similar to MDC12.19: Protein GET4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g63220`	Involved in the regulation of root hair growth.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_012641 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006511 ubiquitin-dependent protein catabolic process Biological Process

GO:0006620 post-translational protein targeting to endoplasmic reticulum membrane Biological Process

GO:0031647 regulation of protein stability Biological Process

GO:0036503 ERAD pathway Biological Process

GO:0036506 maintenance of unfolded protein Biological Process

GO:0045048 protein insertion into ER membrane Biological Process

GO:0048767 root hair elongation Biological Process

GO:0071816 tail-anchored membrane protein insertion into ER membrane Biological Process

GO:0005654 nucleoplasm Cellular Component

GO:0005694 chromosome Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0005737 cytoplasm Cellular Component

KEGG gene cross-reference

ath:AT5G63220

ddi:DDB_G0281815

hsa:51608

mmu:67604

tgu:100190551

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.694

Rank 1 · TkA02G547650 · TK1151

Nucleus0.293

Rank 2 · TkA02G547650 · TK1151

Cell membrane0.118

Rank 3 · TkA02G547650 · TK1151

Golgi apparatus0.099

Rank 4 · TkA02G547650 · TK1151

Lysosome / Vacuole0.091

Rank 5 · TkA02G547650 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04190GET449-320 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G547650	`PF04190`	GET4	49	320	8.7e-69	232.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q6GKV1`	Arabidopsis thaliana	sp\|Q6GKV1\|GET4_ARATH Protein GET4	62.800%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card