TkA02G535610 | RubberDandelionOmics

Gene overview

TkA02G535610

Reference: TK1151 Chr: Chr02 Coordinates: 138120626-138121886 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1187 bp · TkA02G535610|TK1151|cDNA

ATGTAAAATATATATGAGGTGTATATTTAGTAACACCCACAAAAGAATAACATTGAAATTGACTGTTGAATTTTGAAAGTCAAGAAAGGCTCCCCACTTTTGAGACATTCATACCCTACCCCACAAGACATCTCTTGGAATCTTCCGATAACCACGTATCCCAATACCACAACCACCGTTTATTCCTTTAATTTAGACATTTTCGCAAACACCTAACCTTCACCTTTCTATATTTCCTCCACCATCCCCATAAATCGATC...

CDS

Download CDS FASTA

486 bp · TkA02G535610|TK1151|CDS

ATGGCAGAGGAACAGAATTGGGAAGAAACAAGCAATCATACGCCTTGCGCAAATAACTGCGGGTTCTTTGGGAGCCCCACAACGCTCGATTTCTGCTCCAAGTGCTACAAAGATCATTGCTTAAAGGACCAACAGATGTCAAAGGCCAAGCTAGCCGTTGAGAAGAGCCTCTCTCAGCCGCAACAGCAATCAGAAACAACTTTTTCTTCCTCGTCCTCCCCAGCTGCAGTACCTTCATTCGATCCATTGGTGGTTGCGGA...

Protein

Download Protein FASTA

161 aa · TkA02G535610|TK1151|PROTEIN

MAEEQNWEETSNHTPCANNCGFFGSPTTLDFCSKCYKDHCLKDQQMSKAKLAVEKSLSQPQQQSETTFSSSSSPAAVPSFDPLVVAEAVPEVAVKSQPRNRCGSCNRRVGLTGFTCRCGMTCCGTHRYPEHHGCTFDYKTMGKEAIAKANPVIKASKLEKI

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G535610`
TK1151 ID	TkA02G535610
OH-1004 ID	LXL04_012845
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.800
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G535610

Location Chr02:138120626-138121886 (-)

Description Similar to SAP4: Zinc finger A20 and AN1 domain-containing stress-associated protein 4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g36320`	May be involved in environmental stress response.	No verified direct reference in this release
`At1g12440`	May be involved in environmental stress response.	No verified direct reference in this release
`At3g52800`	May be involved in environmental stress response.	No verified direct reference in this release
`At1g51200`	May be involved in environmental stress response.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0530300`	May be involved in environmental stress response.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_012845 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009408 response to heat Biological Process

GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process Biological Process

GO:0098542 defense response to other organism Biological Process

GO:0005634 nucleus Cellular Component

GO:0003677 DNA binding Molecular Function

GO:0008270 zinc ion binding Molecular Function

GO:0061630 ubiquitin protein ligase activity Molecular Function

KEGG gene cross-reference

ath:AT1G12440

ath:AT2G27580

ath:AT2G36320

ath:AT4G22820

dosa:Os02g0530300

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.707

Rank 1 · TkA02G535610 · TK1151

Cytoplasm0.375

Rank 2 · TkA02G535610 · TK1151

Mitochondrion0.045

Rank 3 · TkA02G535610 · TK1151

Cell membrane0.024

Rank 4 · TkA02G535610 · TK1151

Endoplasmic reticulum0.018

Rank 5 · TkA02G535610 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01754zf-A2015-42 aa

PF01428zf-AN132-42 aa

PF01754zf-A2099-103 aa

PF01428zf-AN1103-139 aa

PF01754zf-A20133-136 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G535610	`PF01754`	zf-A20	15	42	3e-13	49.8
TkA02G535610	`PF01428`	zf-AN1	32	42	9.5e-08	32.8
TkA02G535610	`PF01754`	zf-A20	99	103	3e-13	49.8
TkA02G535610	`PF01428`	zf-AN1	103	139	9.5e-08	32.8
TkA02G535610	`PF01754`	zf-A20	133	136	3e-13	49.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SJM6`	Arabidopsis thaliana	sp\|Q9SJM6\|SAP4_ARATH Zinc finger A20 and AN1 domain-containing stress-associated protein 4	47.800%	Swiss-Prot	Medium
`Q6NNI8`	Arabidopsis thaliana	sp\|Q6NNI8\|SAP1_ARATH Zinc finger A20 and AN1 domain-containing stress-associated protein 1	47.400%	Swiss-Prot	Medium
`Q94B40`	Arabidopsis thaliana	sp\|Q94B40\|SAP6_ARATH Zinc finger A20 and AN1 domain-containing stress-associated protein 6	46.500%	Swiss-Prot	Medium
`Q8H0X0`	Arabidopsis thaliana	sp\|Q8H0X0\|SAP2_ARATH Zinc finger A20 and AN1 domain-containing stress-associated protein 2	47.800%	Swiss-Prot	Medium
`Q6H754`	Oryza sativa subsp. japonica	sp\|Q6H754\|SAP5_ORYSJ Zinc finger A20 and AN1 domain-containing stress-associated protein 5	49.700%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card