Gene Card
Gene overview
cDNA / CDS / Protein Sequences
3461 bp · TkA02G532810|TK1151|cDNA
TAGCAAACAAATACAGCCCAATTTGCTTAGACCCTAAAATCAGTTCTCCACTAGCAGTGTGCTATTTGCTAACGCTAATATTAACAGTTTGCCGGAACTTCAAAAACCACCCGCCAATCGAACCTGACTCGCCGTCGACGGCAACCTTTACCTAAGCTAAAAGCACAAACGCAAACAGAATGAGGAAGAAGGTGGACGAACGTATCAGAACCCTAATTGAGAATGGAGTCAAAAGCAGACATCGTTCCATGTTCGTCATT...
1425 bp · TkA02G532810|TK1151|CDS
ATGCTCGAGTACAAGGAGCATTTGGATTATGATATTGTGAAAAGTTCAAATCCAGAGATGAAAAAAGTAACAATCAGAATAAACATTTACAAACAACACAGACAAACAATCCAATACATACAACCACACGAACATGGAAAGCTCTCACAAGTTGAGCTTTTGGTGGTTGATGAAGCTGCAGCTATCCCACTGCCACTTGTCAAATCCTTATTGGGTCCTTATCTTGTTTTCCTTTCATCTACTGTAAATGGTTATGAAGG...
Protein
Download Protein FASTA474 aa · TkA02G532810|TK1151|PROTEIN
MLEYKEHLDYDIVKSSNPEMKKVTIRINIYKQHRQTIQYIQPHEHGKLSQVELLVVDEAAAIPLPLVKSLLGPYLVFLSSTVNGYEGTGRSLSLKLLQQLEEQSRVSTKNKESVPSGRLFRKIDLSEAIRYSNGDPIELWLNNLLCLDIANSIPSINRLPPPSECDLYYVNRDTLFSYHKDSELFLQRMMALYVASHYKNSPNDLQLLADAPAHHLFVLLGPVNEARNQLPDILCVIQVCLEGKISQASAMRSLSAGHQP...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA02G532810 |
|---|---|
| TK1151 ID | TkA02G532810 |
| OH-1004 ID | LXL04_013526 |
| Relationship / confidence | Non Reciprocal Best Hit / Complex relationship |
| Protein identity (%) | 93.000 |
| Protein coverage (%) | TK1151 99.367 / OH-1004 45.124Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA02G532810 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr02:137334758-137341395 (-) | |||||||||
| Description | Similar to At1g10490: RNA cytidine acetyltransferase 1 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0000154 rRNA modification Biological Process GO:0002101 tRNA wobble cytosine modification Biological Process GO:0006417 regulation of translation Biological Process GO:0006473 protein acetylation Biological Process GO:0010824 regulation of centrosome duplication Biological Process GO:0030490 maturation of SSU-rRNA Biological Process GO:0032211 negative regulation of telomere maintenance via telomerase Biological Process GO:0042274 ribosomal small subunit biogenesis Biological Process GO:0045727 positive regulation of translation Biological Process GO:0051391 tRNA acetylation Biological Process GO:1904812 rRNA acetylation involved in maturation of SSU-rRNA Biological Process GO:0000781 chromosome, telomeric region Cellular Component | |||||||||
| KEGG gene cross-reference | ath:AT1G10490 ath:AT3G57940 ddi:DDB_G0268868 hsa:55226 mmu:98956 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF05127NAT10_TcmA_helicase20-148 aaPF13718GNAT_acetyltr_2188-419 aaPF13725tRNA_bind_2433-470 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA02G532810 | PF05127 | NAT10_TcmA_helicase | 20 | 148 | 1.2e-34 | 120.5 |
| TkA02G532810 | PF13718 | GNAT_acetyltr_2 | 188 | 419 | 1.7e-99 | 332.6 |
| TkA02G532810 | PF13725 | tRNA_bind_2 | 433 | 470 | 0.029 | 14.8 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.