TkA02G523470 | RubberDandelionOmics

Gene overview

TkA02G523470

Reference: TK1151 Chr: Chr02 Coordinates: 134991119-134991669 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

369 bp · TkA02G523470|TK1151|cDNA

ATGAACGGTCAAGATTTCTTTAAAGAATCCATACCCGAATCACATTTATCAGCTATTGATTCTTTCAATCGTCCATCTGATGACACCCCAATGCCACCTGGCGGTTTACATGCTTCCATGATATTAAGCAAGAAGCCTCATGCACGACTCCTTTCAATTGATGATTCCGGTGCCAGGTCATCACGGGGATTCGCCGTAATCTTTTTTGCCAAAGACATTCCGGGAGATAATGCCACCGGTCCTGTTGTTGAAGATGAACA...

CDS

Download CDS FASTA

369 bp · TkA02G523470|TK1151|CDS

ATGAACGGTCAAGATTTCTTTAAAGAATCCATACCCGAATCACATTTATCAGCTATTGATTCTTTCAATCGTCCATCTGATGACACCCCAATGCCACCTGGCGGTTTACATGCTTCCATGATATTAAGCAAGAAGCCTCATGCACGACTCCTTTCAATTGATGATTCCGGTGCCAGGTCATCACGGGGATTCGCCGTAATCTTTTTTGCCAAAGACATTCCGGGAGATAATGCCACCGGTCCTGTTGTTGAAGATGAACA...

Protein

Download Protein FASTA

122 aa · TkA02G523470|TK1151|PROTEIN

MNGQDFFKESIPESHLSAIDSFNRPSDDTPMPPGGLHASMILSKKPHARLLSIDDSGARSSRGFAVIFFAKDIPGDNATGPVVEDEQIFASDIVTCVGQVIGVVVSDTHENAKLACNKKSCD

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G523470`
TK1151 ID	TkA02G523470
OH-1004 ID	LXL04_013005
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	72.100
Protein coverage (%)	TK1151 96.721 / OH-1004 33.921 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G523470

Location Chr02:134991119-134991669 (-)

Description No functional description available

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g34890`	Key enzyme involved in purine catabolism.	Tandem orientation of duplicated xanthine dehydrogenase genes from Arabidopsis thaliana: differential gene expression and enzyme activities.2004 · DOI: 10.1074/jbc.m312929200 The plant Mo-hydroxylases aldehyde oxidase and xanthine dehydrogenase have distinct reactive oxygen species signatures and are induced by drought and abscisic acid.2005 · DOI: 10.1111/j.1365-313x.2005.02422.x The RNAi-mediated silencing of xanthine dehydrogenase impairs growth and fertility and accelerates leaf senescence in transgenic Arabidopsis plants.2007 · DOI: 10.1093/pcp/pcm119 A critical role for ureides in dark and senescence-induced purine remobilization is unmasked in the Atxdh1 Arabidopsis mutant.2008 · DOI: 10.1111/j.1365-313x.2008.03440.x Xanthine dehydrogenase AtXDH1 from Arabidopsis thaliana is a potent producer of superoxide anions via its NADH oxidase activity.2010 · DOI: 10.1007/s11103-009-9570-2
`At4g34900`	Key enzyme involved in purine catabolism.	The RNAi-mediated silencing of xanthine dehydrogenase impairs growth and fertility and accelerates leaf senescence in transgenic Arabidopsis plants.2007 · DOI: 10.1093/pcp/pcm119

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0429800`	Key enzyme involved in purine catabolism.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013005 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000302 response to reactive oxygen species Biological Process

GO:0006145 purine nucleobase catabolic process Biological Process

GO:0009115 xanthine catabolic process Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0034418 urate biosynthetic process Biological Process

GO:0042554 superoxide anion generation Biological Process

GO:0046110 xanthine metabolic process Biological Process

GO:0005615 extracellular space Cellular Component

GO:0005777 peroxisome Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0004854 xanthine dehydrogenase activity Molecular Function

KEGG gene cross-reference

ath:AT4G34890

ath:AT4G34900

ddi:DDB_G0291047

dosa:Os03g0429800

gga:396025

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.691

Rank 1 · TkA02G523470 · TK1151

Nucleus0.322

Rank 2 · TkA02G523470 · TK1151

Peroxisome0.072

Rank 3 · TkA02G523470 · TK1151

Mitochondrion0.062

Rank 4 · TkA02G523470 · TK1151

Endoplasmic reticulum0.032

Rank 5 · TkA02G523470 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01315Ald_Xan_dh_C27-117 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G523470	`PF01315`	Ald_Xan_dh_C	27	117	1.2e-20	74.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8GUQ8`	Arabidopsis thaliana	sp\|Q8GUQ8\|XDH1_ARATH Xanthine dehydrogenase 1	64.200%	Swiss-Prot	High
`F4JLI5`	Arabidopsis thaliana	sp\|F4JLI5\|XDH2_ARATH Xanthine dehydrogenase 2	60.400%	Swiss-Prot	High
`Q6AUV1`	Oryza sativa subsp. japonica	sp\|Q6AUV1\|XDH_ORYSJ Xanthine dehydrogenase	63.400%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card