TkA02G513380 | RubberDandelionOmics

Gene overview

TkA02G513380

Reference: TK1151 Chr: Chr02 Coordinates: 131792269-131794065 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1151 bp · TkA02G513380|TK1151|cDNA

ATTAAACCTCAACAATTACACAAATCAGCCTCTTCCAAACACAAATCGCACACGGAAGAAACACATCGCACACCTGAGCGCCGATCCACAAATCGGGATATCCTTCCCCGTCGATTGCCGCCGCCGATCGGAGCCGACCACCTACGATTCCACATCCGGCACAACCTCCGAACAGACAAAGGTCAATAGTTCCCAACAATGGCAGACTATCACTTTGTGTACAAAGATGTTGAAGGAGCATCAACACAATGGGACGACAT...

CDS

Download CDS FASTA

750 bp · TkA02G513380|TK1151|CDS

ATGGCAGACTATCACTTTGTGTACAAAGATGTTGAAGGAGCATCAACACAATGGGACGACATCCAAAGAAAGCTCGGAAACCTCCCTCCCAAACCCCCTGCCTTCAAACCCGACCCTTTCACACCTGCAGAAGACGAAGACTCCCAACCTAAAACCAAATCCTGGATCGATAACAAAACAGAAGAAGAACTCGAAGATCTAGAAGACGATCTTGACGACAGTCGTTTCCTCGAAGAATACAGGCGAAAGAGGCTAGCAGA...

Protein

Download Protein FASTA

249 aa · TkA02G513380|TK1151|PROTEIN

MADYHFVYKDVEGASTQWDDIQRKLGNLPPKPPAFKPDPFTPAEDEDSQPKTKSWIDNKTEEELEDLEDDLDDSRFLEEYRRKRLAEMKQVVKIAKFGSIIPISGSDFVREVSQAPSDVWVVVILYKDGYPECGVLMQCVEELARMYSATKFVKIISTECIPNYPDCNLPTVLVYNNGAVKANYVGLHTFGRRCTPEGVAMVLCQSDPVLNDGQSGEASREAVLEGVRKRFIEKVVTLHENDDDGSSSD

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G513380`
TK1151 ID	TkA02G513380
OH-1004 ID	LXL04_013185
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA02G513380`
Location	Chr02:131792269-131794065 (-)
Description	Similar to PDCL3: Phosducin-like protein 3
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_013185` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0001938 positive regulation of endothelial cell proliferation Biological Process GO:0006457 protein folding Biological Process GO:0010628 positive regulation of gene expression Biological Process GO:0030036 actin cytoskeleton organization Biological Process GO:0034605 cellular response to heat Biological Process GO:0050730 regulation of peptidyl-tyrosine phosphorylation Biological Process GO:0050821 protein stabilization Biological Process GO:1903333 negative regulation of protein folding Biological Process GO:2000059 negative regulation of ubiquitin-dependent protein catabolic process Biological Process GO:0005654 nucleoplasm Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005783 endoplasmic reticulum Cellular Component
KEGG gene cross-reference	dme:Dmel_CG18593 dre:403034 hsa:79031 pon:100172481 rno:316348 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.642

Rank 1 · TkA02G513380 · TK1151

Nucleus0.420

Rank 2 · TkA02G513380 · TK1151

Cell membrane0.072

Rank 3 · TkA02G513380 · TK1151

Endoplasmic reticulum0.057

Rank 4 · TkA02G513380 · TK1151

Golgi apparatus0.052

Rank 5 · TkA02G513380 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02114Phosducin55-186 aa

PF00085Thioredoxin102-187 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G513380	`PF02114`	Phosducin	55	186	1.3e-15	57.8
TkA02G513380	`PF00085`	Thioredoxin	102	187	0.16	12.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card