TkA02G505250 | RubberDandelionOmics

Gene overview

TkA02G505250

Reference: TK1151 Chr: Chr02 Coordinates: 129618701-129623055 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

4044 bp · TkA02G505250|TK1151|cDNA

ATTAGAAATTAGAATACTATACTACCGCTGATATATTGTTACAACTTAGTATATAAATATCATAGCAATGGAGGAAAAACTGTATATAGCAATTGACTAAGAAACGACGACCTGAGGGATTTTGGGTCCAGTGCTTGAAGGCTAAACCAGAACCGATGTCCAAGACGATCTTGTATTGACTCAAAGGCCTGACTGAGTGACCGTCTTCTTCGGCTACTCCGCCGATCTCATCCCAATGGCCTTTGCCTCTTCTCACGCCG...

CDS

Download CDS FASTA

2028 bp · TkA02G505250|TK1151|CDS

ATGGCCTTTGCCTCTTCTCACGCCGGCAACTCCAACGTCCGTCGTGGAATCGGCGGCGGTTGGACCCGCTCTCTCCTACCTTTCACATCATCAACCACCAAATCCGCTAAACACATTCGTAAATCTCGCAAACGTGCTGCCCTCAAAGACTTCTTATTCGCAAATTTCTTCACCATCGGACTCGGCGCATCTATCTTCTTCTTCTTTATCGTTGTTTACCTATACGGAGTTCCAAAACCCATCTCCTCGCAATTCCGTAC...

Protein

Download Protein FASTA

675 aa · TkA02G505250|TK1151|PROTEIN

MAFASSHAGNSNVRRGIGGGWTRSLLPFTSSTTKSAKHIRKSRKRAALKDFLFANFFTIGLGASIFFFFIVVYLYGVPKPISSQFRTGNSRVLRVRKPVYRKTSSLGHVPSNHSNLSLGAAAVDLTTKDLYDKIEFKDVDGGPWTQGWRVSYKGDEWNTEKLKVFVVPHSHNDPGWKLTVEEYYDRQSRHILDTIIETLSKDERRKFIWEEMSYLERWWRDASDTKRESLIKLLQNGQLEIVGGGWVMNDEANSHYFAII...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G505250`
TK1151 ID	TkA02G505250
OH-1004 ID	LXL04_013324
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 90.222 / OH-1004 52.007 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G505250

Location Chr02:129618701-129623055 (+)

Description Similar to GMII: Alpha-mannosidase 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g14950`	Catalyzes the first committed step in the biosynthesis of complex N-glycans.	Molecular cloning and characterization of Arabidopsis thaliana Golgi alpha-mannosidase II, a key enzyme in the formation of complex N-glycans in plants.2006 · DOI: 10.1111/j.1365-313x.2005.02648.x Reduced immunogenicity of Arabidopsis hgl1 mutant N-glycans caused by altered accessibility of xylose and core fucose epitopes.2011 · DOI: 10.1074/jbc.m110.196097

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013324 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006013 mannose metabolic process Biological Process

GO:0006491 N-glycan processing Biological Process

GO:0007005 mitochondrion organization Biological Process

GO:0007033 vacuole organization Biological Process

GO:0007585 respiratory gaseous exchange by respiratory system Biological Process

GO:0042538 hyperosmotic salinity response Biological Process

GO:0000137 Golgi cis cisterna Cellular Component

GO:0000139 Golgi membrane Cellular Component

GO:0005615 extracellular space Cellular Component

GO:0005768 endosome Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005797 Golgi medial cisterna Cellular Component

KEGG gene cross-reference

ath:AT5G14950

hsa:4122

mmu:140481

mmu:17158

rno:25478

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.690

Rank 1 · TkA02G505250 · TK1151

Endoplasmic reticulum0.217

Rank 2 · TkA02G505250 · TK1151

Cytoplasm0.080

Rank 3 · TkA02G505250 · TK1151

Cell membrane0.074

Rank 4 · TkA02G505250 · TK1151

Extracellular0.046

Rank 5 · TkA02G505250 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF26835Phage_T4_Y04K131-166 aa

PF03065Glyco_hydro_57151-317 aa

PF01074Glyco_hydro_38N161-503 aa

PF18470Cas9_a210-238 aa

PF26835Phage_T4_Y04K501-525 aa

PF03065Glyco_hydro_57504-561 aa

PF09261Alpha-mann_mid508-608 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G505250	`PF26835`	Phage_T4_Y04K	131	166	0.029	15.5
TkA02G505250	`PF03065`	Glyco_hydro_57	151	317	0.0041	17.2
TkA02G505250	`PF01074`	Glyco_hydro_38N	161	503	7.1e-90	301.8
TkA02G505250	`PF18470`	Cas9_a	210	238	0.0072	16.7
TkA02G505250	`PF26835`	Phage_T4_Y04K	501	525	0.029	15.5
TkA02G505250	`PF03065`	Glyco_hydro_57	504	561	0.0041	17.2
TkA02G505250	`PF09261`	Alpha-mann_mid	508	608	1.2e-21	77.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LFR0`	Arabidopsis thaliana	sp\|Q9LFR0\|GMAN2_ARATH Alpha-mannosidase 2	77.300%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card