TkA02G499450 | RubberDandelionOmics

Gene overview

TkA02G499450

Reference: TK1151 Chr: Chr02 Coordinates: 127966130-127966767 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

339 bp · TkA02G499450|TK1151|cDNA

ATGTCATTCAAGGGAAATGCTCTCATTCAAGGCTATAATAAATGCAAATTCAAAGCCAAAGTTCAGATTGATCAACACACTTCCTCAAGTGCTCACCAAGTTGTTTCATGGAAGAACTATCTATATGTTTATGGTGACGAATTTACCTCTCCTAATCAAGAGTGTTTCCATGACTACAAGTACTTTTGGATGTTGGATTTGAAAACAAATCAATGGGAACAATTAGATTATAAAGGTTGCCATAGTCCACGTTCTAGTCA...

CDS

Download CDS FASTA

339 bp · TkA02G499450|TK1151|CDS

ATGTCATTCAAGGGAAATGCTCTCATTCAAGGCTATAATAAATGCAAATTCAAAGCCAAAGTTCAGATTGATCAACACACTTCCTCAAGTGCTCACCAAGTTGTTTCATGGAAGAACTATCTATATGTTTATGGTGACGAATTTACCTCTCCTAATCAAGAGTGTTTCCATGACTACAAGTACTTTTGGATGTTGGATTTGAAAACAAATCAATGGGAACAATTAGATTATAAAGGTTGCCATAGTCCACGTTCTAGTCA...

Protein

Download Protein FASTA

112 aa · TkA02G499450|TK1151|PROTEIN

MSFKGNALIQGYNKCKFKAKVQIDQHTSSSAHQVVSWKNYLYVYGDEFTSPNQECFHDYKYFWMLDLKTNQWEQLDYKGCHSPRSSHRMVCSHLLVSLCHPSFMFLRLPCKS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G499450`
TK1151 ID	TkA02G499450
OH-1004 ID	LXL04_006356
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	87.900
Protein coverage (%)	TK1151 87.500 / OH-1004 32.143 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA02G499450`
Location	Chr02:127966130-127966767 (-)
Description	Similar to AGT2: Alanine--glyoxylate aminotransferase 2 homolog 1, mitochondrial
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_006356` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0009436 glyoxylate catabolic process Biological Process GO:0009853 photorespiration Biological Process GO:0019265 glycine biosynthetic process, by transamination of glyoxylate Biological Process GO:0019481 L-alanine catabolic process, by transamination Biological Process GO:0043562 cellular response to nitrogen levels Biological Process GO:0045429 positive regulation of nitric oxide biosynthetic process Biological Process GO:2001299 N(omega),N(omega)-dimethyl-L-arginine catabolic process Biological Process GO:0000325 plant-type vacuole Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005739 mitochondrion Cellular Component GO:0005759 mitochondrial matrix Cellular Component GO:0005886 plasma membrane Cellular Component
KEGG gene cross-reference	ath:AT3G08860 ath:AT4G39660 bta:521553 hsa:64902 pon:100171524 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.421

Rank 1 · TkA02G499450 · TK1151

Nucleus0.391

Rank 2 · TkA02G499450 · TK1151

Mitochondrion0.114

Rank 3 · TkA02G499450 · TK1151

Extracellular0.114

Rank 4 · TkA02G499450 · TK1151

Endoplasmic reticulum0.063

Rank 5 · TkA02G499450 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13854Kelch_HCF20-88 aa

PF24981Beta-prop_ATRN-LZTR125-87 aa

PF24681Kelch_KLHDC2_KLHL20_DRC727-91 aa

PF13415Beta-prop_FBX4228-90 aa

PF07646Kelch_230-76 aa

PF01344Kelch_131-45 aa

PF01344Kelch_161-75 aa

PF07646Kelch_287-93 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G499450	`PF13854`	Kelch_HCF	20	88	0.026	14.5
TkA02G499450	`PF24981`	Beta-prop_ATRN-LZTR1	25	87	2.4e-05	24.5
TkA02G499450	`PF24681`	Kelch_KLHDC2_KLHL20_DRC7	27	91	8.1e-08	32.5
TkA02G499450	`PF13415`	Beta-prop_FBX42	28	90	5.6e-06	26.8
TkA02G499450	`PF07646`	Kelch_2	30	76	0.24	12.2
TkA02G499450	`PF01344`	Kelch_1	31	45	0.0015	18.7
TkA02G499450	`PF01344`	Kelch_1	61	75	0.0015	18.7
TkA02G499450	`PF07646`	Kelch_2	87	93	0.24	12.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card