TkA02G494470 | RubberDandelionOmics

Gene overview

TkA02G494470

Reference: TK1151 Chr: Chr02 Coordinates: 126586228-126590050 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2930 bp · TkA02G494470|TK1151|cDNA

GAATAATGTTATGTCGATACAGATATATAGAATGATGGGAAATTGAAATGTTATCCCTGTCCGTGTCTTCATTCGGTCGTATATGAAAGGGAAATCGTGGTTGCAATCAAACAACCACATGACAGGCCACAAACAAACTCTCTAAAACATGCCCTTCATGATGTTCGCTTTGACTTCCCTTCTACGATCACCTTCAAGACCTCTTCAAAGTCGCTCCCACGTTACCTTTGCACGAATCTAGGCCTACCACCTTCTCTAAA...

CDS

Download CDS FASTA

2118 bp · TkA02G494470|TK1151|CDS

ATGGCTTCGACATCGCCTTCTCCGGGATCTTCTCCCTCATCGGTCCCTCCTGTTTCTTCAAACCCTGTGCCTGATTCCCCTGTTTCTCAGCCCGATCAAGCCACAGGAACACCGCCGCCTCCAGACACTCCGTCAACTTCAGCTCCACCGCTTCAATTGCCTCCACTACCGGTCGCCACTTCACCACCTCCATCTCCACCACAATCGCCTCCACCAGATGCATCATCACCACCACCACCGGACCTACCTGCTTCTCCTCC...

Protein

Download Protein FASTA

705 aa · TkA02G494470|TK1151|PROTEIN

MASTSPSPGSSPSSVPPVSSNPVPDSPVSQPDQATGTPPPPDTPSTSAPPLQLPPLPVATSPPPSPPQSPPPDASSPPPPDLPASPPPSPPAAPPPATTPPPLPPPVTATPPPASSPPPPDPSPPPPDPSPPPPPSAGSPPPEPTPSPPPPLSDPASSPPSPSPPAPISPSPPPPADVLSPPVSASPPPPRTNPPINSPPRPPAPPTNTSINPPSSRSSPPPSSTPTNPSTPPTSQLPPPPTEKPTARSTDTTTNFTQNG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G494470`
TK1151 ID	TkA02G494470
OH-1004 ID	LXL04_013470
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.900
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G494470

Location Chr02:126586228-126590050 (-)

Description Similar to PERK9: Proline-rich receptor-like protein kinase PERK9

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g38560`	Could be involved in the negative regulation of root growth.	PERK-KIPK-KCBP signalling negatively regulates root growth in Arabidopsis thaliana.2015 · DOI: 10.1093/jxb/eru390
`At1g68690`	Could be involved in the negative regulation of root growth.	No verified direct reference in this release
`At1g26150`	Could be involved in the negative regulation of root growth.	No verified direct reference in this release
`At1g70460`	Negatively regulates root hair elongation.	No verified direct reference in this release
`At1g10620`	Putative proline-rich receptor-like protein kinase PERK11.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013470 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006995 cellular response to nitrogen starvation Biological Process

GO:0007165 signal transduction Biological Process

GO:0009611 response to wounding Biological Process

GO:0009620 response to fungus Biological Process

GO:0016036 cellular response to phosphate starvation Biological Process

GO:0046777 protein autophosphorylation Biological Process

GO:0071456 cellular response to hypoxia Biological Process

GO:1990641 response to iron ion starvation Biological Process

GO:0005634 nucleus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0090406 pollen tube Cellular Component

GO:0004672 protein kinase activity Molecular Function

KEGG gene cross-reference

ath:AT1G26150

ath:AT1G68690

ath:AT1G70460

ath:AT3G24550

ath:AT4G34440

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.861

Rank 1 · TkA02G494470 · TK1151

Nucleus0.092

Rank 2 · TkA02G494470 · TK1151

Cytoplasm0.091

Rank 3 · TkA02G494470 · TK1151

Endoplasmic reticulum0.060

Rank 4 · TkA02G494470 · TK1151

Plastid0.016

Rank 5 · TkA02G494470 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07714PK_Tyr_Ser-Thr378-647 aa

PF00069Pkinase378-578 aa

PF03109ABC1385-403 aa

PF17667Pkinase_fungal415-441 aa

PF01636APH431-522 aa

PF17667Pkinase_fungal478-564 aa

PF03109ABC1485-521 aa

PF01636APH613-638 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G494470	`PF07714`	PK_Tyr_Ser-Thr	378	647	4.2e-45	154.8
TkA02G494470	`PF00069`	Pkinase	378	578	5.3e-44	151.3
TkA02G494470	`PF03109`	ABC1	385	403	0.017	15.0
TkA02G494470	`PF17667`	Pkinase_fungal	415	441	0.00039	20.0
TkA02G494470	`PF01636`	APH	431	522	0.017	15.6
TkA02G494470	`PF17667`	Pkinase_fungal	478	564	0.00039	20.0
TkA02G494470	`PF03109`	ABC1	485	521	0.017	15.0
TkA02G494470	`PF01636`	APH	613	638	0.017	15.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FFW5`	Arabidopsis thaliana	sp\|Q9FFW5\|PERK8_ARATH Proline-rich receptor-like protein kinase PERK8	70.100%	Swiss-Prot	Medium
`Q9SX31`	Arabidopsis thaliana	sp\|Q9SX31\|PERK9_ARATH Proline-rich receptor-like protein kinase PERK9	63.400%	Swiss-Prot	Medium
`Q9C660`	Arabidopsis thaliana	sp\|Q9C660\|PEK10_ARATH Proline-rich receptor-like protein kinase PERK10	65.700%	Swiss-Prot	Medium
`Q9CAL8`	Arabidopsis thaliana	sp\|Q9CAL8\|PEK13_ARATH Proline-rich receptor-like protein kinase PERK13	59.600%	Swiss-Prot	Medium
`Q9SGY7`	Arabidopsis thaliana	sp\|Q9SGY7\|PEK11_ARATH Putative proline-rich receptor-like protein kinase PERK11	60.200%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card