Gene Card
Gene overview
cDNA / CDS / Protein Sequences
420 bp · TkA02G487080|TK1151|cDNA
TCTCGGCCCATTTATGCCATTCTATTTTTTAGCCCAGTTGAACTGCGGGTTAAACCCTGAAATTGTTTTAACCAATTCACACAAAAACAATGGCTTGGCGTTGCGGATCCCTGCCGAGGTCGCTGATTTCCACCGCCAGATCTTCAACAATCCGTCGTCCCACCACCACTTTCCTCCCTCATCTACGTCCTCCTCCGCAACCAAGCCTACACGGCCATCGCCTCCGTCCCGGCCCCACGCCTTCCCTCCCTGGTTTCGGG...
474 bp · TkA02G487080|TK1151|CDS
ATGCCATTCTATTTTTTAGCCCAGTTGAACTGCGGGTTAAACCCTGAAATTGTTTTAACCAATTCACACAAAAACAATGGCTTGGCGTTGCGGATCCCTGCCGAGGTCGCTGATTTCCACCGCCAGATCTTCAACAATCCGTCGTCCCACCACCACTTTCCTCCCTCATCTACGTCCTCCTCCGCAACCAAGCCTACACGGCCATCGCCTCCGTCCCGGCCCCACGCCTTCCCTCCCTGGTTTCGGGACTATTGGAGGAG...
Protein
Download Protein FASTA157 aa · TkA02G487080|TK1151|PROTEIN
MPFYFLAQLNCGLNPEIVLTNSHKNNGLALRIPAEVADFHRQIFNNPSSHHHFPPSSTSSSATKPTRPSPPSRPHAFPPWFRDYWRSTWLHSIAAAVAQCGRCCSLNVSRRRRRPRLLRAFSGPSLLVQYSKPKFGIRNSRPSINWELETFSGSPRL
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA02G487080 |
|---|---|
| TK1151 ID | TkA02G487080 |
| OH-1004 ID | LXL04_013579 |
| Relationship / confidence | Rbh Below Probable Coverage Or Synteny Threshold / Review |
| Protein identity (%) | 100.000 |
| Protein coverage (%) | TK1151 19.745 / OH-1004 24.409Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA02G487080 |
|---|---|
| Location | Chr02:124587806-124595611 (-) |
| Description | Similar to NOXY2: Protein NONRESPONDING TO OXYLIPINS 2, mitochondrial |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0009617 response to bacterium Biological Process GO:0009635 response to herbicide Biological Process GO:0010311 lateral root formation Biological Process GO:0010821 regulation of mitochondrion organization Biological Process GO:0019372 lipoxygenase pathway Biological Process GO:0031407 oxylipin metabolic process Biological Process GO:0042742 defense response to bacterium Biological Process GO:0048311 mitochondrion distribution Biological Process GO:0048364 root development Biological Process GO:0050832 defense response to fungus Biological Process GO:0052543 callose deposition in cell wall Biological Process GO:0071433 cell wall repair Biological Process |
| KEGG gene cross-reference | ath:AT5G11630 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
No result was found for this query.
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.