TkA02G486840 | RubberDandelionOmics

Gene overview

TkA02G486840

Reference: TK1151 Chr: Chr02 Coordinates: 124497366-124498573 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

783 bp · TkA02G486840|TK1151|cDNA

ATGAAAACGAGAACGCGAGAACAAACGTGGAGCCTTGATCAATTCAAGTGGCATTTTTGTAATTCTGAGACCACCGGACCACCACCTGCACCCACCGGACCACCGTCGGTGCACCACCTGCACCCATCGGCACATTGGACCACTGATGCACCACCGCCGGACCACCGCCGGATCACAGTTTCGAGATGGGGAAATCAGCAAGCTGAAAACGTTCAATTTCCGTTACCGGCCAATGAGTCTCGTGAGCAATCACCGGAAAC...

CDS

Download CDS FASTA

783 bp · TkA02G486840|TK1151|CDS

ATGAAAACGAGAACGCGAGAACAAACGTGGAGCCTTGATCAATTCAAGTGGCATTTTTGTAATTCTGAGACCACCGGACCACCACCTGCACCCACCGGACCACCGTCGGTGCACCACCTGCACCCATCGGCACATTGGACCACTGATGCACCACCGCCGGACCACCGCCGGATCACAGTTTCGAGATGGGGAAATCAGCAAGCTGAAAACGTTCAATTTCCGTTACCGGCCAATGAGTCTCGTGAGCAATCACCGGAAAC...

Protein

Download Protein FASTA

260 aa · TkA02G486840|TK1151|PROTEIN

MKTRTREQTWSLDQFKWHFCNSETTGPPPAPTGPPSVHHLHPSAHWTTDAPPPDHRRITVSRWGNQQAENVQFPLPANESREQSPETSGNQFTLNQPVIFWTNGGLLGLEPSKPPDFGLPTGPIEEETKTDNPQKTTSNGDTNRLLVNGFRRQISLVGNETLAKSVKSDVPETTTTTPTQKRYPKVTGIPFREQFGNGSPYISPSSPPLDPGAMGEMGSEQQGIAMRKKEVATSRVFWRSSGLFFITHRNSFYLQNCYRI

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G486840`
TK1151 ID	TkA02G486840
OH-1004 ID	LXL04_006684
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	86.900
Protein coverage (%)	TK1151 74.231 / OH-1004 91.416 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G486840

Location Chr02:124497366-124498573 (-)

Description Similar to SCAR3: Protein SCAR3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0208600`	Involved in regulation of actin and microtubule organization.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_006684 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0030036 actin cytoskeleton organization Biological Process

GO:0051127 positive regulation of actin nucleation Biological Process

GO:2000601 positive regulation of Arp2/3 complex-mediated actin nucleation Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005856 cytoskeleton Cellular Component

GO:0031209 SCAR complex Cellular Component

GO:0003779 actin binding Molecular Function

GO:0034237 protein kinase A regulatory subunit binding Molecular Function

GO:0071933 Arp2/3 complex binding Molecular Function

KEGG gene cross-reference

ath:AT1G29170

dosa:Os01g0208600

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.319

Rank 1 · TkA02G486840 · TK1151

Cytoplasm0.270

Rank 2 · TkA02G486840 · TK1151

Cell membrane0.174

Rank 3 · TkA02G486840 · TK1151

Mitochondrion0.133

Rank 4 · TkA02G486840 · TK1151

Extracellular0.116

Rank 5 · TkA02G486840 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF15179Myc_target_161-115 aa

PF15179Myc_target_1150-163 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G486840	`PF15179`	Myc_target_1	61	115	1.3	9.6
TkA02G486840	`PF15179`	Myc_target_1	150	163	1.3	9.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q5QNA6`	Oryza sativa subsp. japonica	sp\|Q5QNA6\|SCRL2_ORYSJ SCAR-like protein 2	43.600%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card