TkA02G484370 | RubberDandelionOmics

Gene overview

TkA02G484370

Reference: TK1151 Chr: Chr02 Coordinates: 123660793-123662880 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1540 bp · TkA02G484370|TK1151|cDNA

GTTCTCTCGTCTCTTCCTCCCACTAAACCCATTTTAAATTCCTTATTTCCGAGAGATTTTAAGAGCAACGATGGTGGTGGCGGCGGCGGCGAGTGGCTACGATGCGGTGGTAGTTATAAGGGAGTACAATCCAAAATTAGACAGTGAGAGAGTACAACAAGTTGAGAGAAACTGTGAGGTAGGTCCTAGCGGCGAATACTCACTCCACGCCGACCTCTTAGGTGACCCTGTTTGCAGAGTTCGCAACTCTCCCGCATATC...

CDS

Download CDS FASTA

1026 bp · TkA02G484370|TK1151|CDS

ATGGTGGTGGCGGCGGCGGCGAGTGGCTACGATGCGGTGGTAGTTATAAGGGAGTACAATCCAAAATTAGACAGTGAGAGAGTACAACAAGTTGAGAGAAACTGTGAGGTAGGTCCTAGCGGCGAATACTCACTCCACGCCGACCTCTTAGGTGACCCTGTTTGCAGAGTTCGCAACTCTCCCGCATATCTCATGCTGGTGGCAGAGATAGCGGTGGACGGCGGTGGAGACGAGACGAGAGAGGTGGTGGGGATGATAAG...

Protein

Download Protein FASTA

341 aa · TkA02G484370|TK1151|PROTEIN

MVVAAAASGYDAVVVIREYNPKLDSERVQQVERNCEVGPSGEYSLHADLLGDPVCRVRNSPAYLMLVAEIAVDGGGDETREVVGMIRGCIKTVTCGRKLSRKANFSPEFRPVFTKLAYILGLRVSPSHRRMKIGLKLVSGMEDWFRNNGAEYSYIATDAANKPSVNLFTGKCGYSEFRNPSVLVHPVFAHRLRVNNRVKIIKLSPSDAETIYRQRFSTTEFFPRDIDSVLKNNLNLGTFLAVPKDCPHSISWTGSDQFLS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G484370`
TK1151 ID	TkA02G484370
OH-1004 ID	LXL04_013615
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.800
Protein coverage (%)	TK1151 99.120 / OH-1004 81.446 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G484370

Location Chr02:123660793-123662880 (-)

Description Similar to At2g23060: Probable N-acetyltransferase HLS1-like

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g37580`	Ethylene-responsive N-acetyltransferase required for differential cell elongation in the hypocotyl.	Involvement of HLS1 in sugar and auxin signaling in Arabidopsis leaves.2006 · DOI: 10.1093/pcp/pcl027 Coordinated regulation of apical hook development by gibberellins and ethylene in etiolated Arabidopsis seedlings.2012 · DOI: 10.1038/cr.2012.29
`At2g23060`	Probable N-acetyltransferase HLS1-like.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os06g0650300`	Possesses intrinsic histone acetyltransferase activity and acts as a positive regulator of grain weight, hull size, yield, and plant biomass.	Regulation of the plastochron by three many-noded dwarf genes in barley.2021 · DOI: 10.1371/journal.pgen.1009292 The ubiquitin-interacting motif-type ubiquitin receptor HDR3 interacts with and stabilizes the histone acetyltransferase GW6a to control the grain size in rice.2021 · DOI: 10.1093/plcell/koab194

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013615 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009640 photomorphogenesis Biological Process

GO:0009723 response to ethylene Biological Process

GO:0009734 auxin-activated signaling pathway Biological Process

GO:0009826 unidimensional cell growth Biological Process

GO:0005634 nucleus Cellular Component

GO:0008080 N-acetyltransferase activity Molecular Function

GO:0016747 acyltransferase activity, transferring groups other than amino-acyl groups Molecular Function

KEGG gene cross-reference

ath:AT2G23060

ath:AT4G37580

osa:107275998

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.307

Rank 1 · TkA02G484370 · TK1151

Nucleus0.256

Rank 2 · TkA02G484370 · TK1151

Cytoplasm0.214

Rank 3 · TkA02G484370 · TK1151

Mitochondrion0.109

Rank 4 · TkA02G484370 · TK1151

Endoplasmic reticulum0.082

Rank 5 · TkA02G484370 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF30377VPS35L_C77-120 aa

PF00583Acetyltransf_180-174 aa

PF13508Acetyltransf_796-175 aa

PF08445FR47117-176 aa

PF24553Rv0428c_C121-164 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G484370	`PF30377`	VPS35L_C	77	120	0.18	10.8
TkA02G484370	`PF00583`	Acetyltransf_1	80	174	8.7e-12	46.1
TkA02G484370	`PF13508`	Acetyltransf_7	96	175	0.0059	17.7
TkA02G484370	`PF08445`	FR47	117	176	0.0097	16.6
TkA02G484370	`PF24553`	Rv0428c_C	121	164	0.41	11.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q42381`	Arabidopsis thaliana	sp\|Q42381\|HLS1_ARATH Probable N-acetyltransferase HLS1	64.700%	Swiss-Prot	High
`O64815`	Arabidopsis thaliana	sp\|O64815\|HLS1L_ARATH Probable N-acetyltransferase HLS1-like	62.300%	Swiss-Prot	High
`Q67UR2`	Oryza sativa subsp. japonica	sp\|Q67UR2\|GW6A_ORYSJ Acetyl transferase GW6a	36.800%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card