TkA02G478880 | RubberDandelionOmics

Gene overview

TkA02G478880

Reference: TK1151 Chr: Chr02 Coordinates: 122218566-122219801 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1236 bp · TkA02G478880|TK1151|cDNA

ATGACGAGAACCAAACGAACCAAAAGAAAACGGCAACATCATAATCCTCCACCACGACCCTCACGGGATCGCAGCAACCAAAAGGCCGATCATTCACCATATTCAGCCTCACAGCGTCCCACCATAAGTTCAGAGCCGAAGCACCGTCAAATCAACCAACAAAAATCAACTGGTAAGCGCCCCGTCTTCGCTTCATACGTCGACACTCCTAATTTACCCCCTAAGGTGAAGCTACTGTGTGAAATTATCGCACAGACATC...

CDS

Download CDS FASTA

1236 bp · TkA02G478880|TK1151|CDS

ATGACGAGAACCAAACGAACCAAAAGAAAACGGCAACATCATAATCCTCCACCACGACCCTCACGGGATCGCAGCAACCAAAAGGCCGATCATTCACCATATTCAGCCTCACAGCGTCCCACCATAAGTTCAGAGCCGAAGCACCGTCAAATCAACCAACAAAAATCAACTGGTAAGCGCCCCGTCTTCGCTTCATACGTCGACACTCCTAATTTACCCCCTAAGGTGAAGCTACTGTGTGAAATTATCGCACAGACATC...

Protein

Download Protein FASTA

411 aa · TkA02G478880|TK1151|PROTEIN

MTRTKRTKRKRQHHNPPPRPSRDRSNQKADHSPYSASQRPTISSEPKHRQINQQKSTGKRPVFASYVDTPNLPPKVKLLCEIIAQTSSLEVDRVLDDAGFRVSTDLVEDVLKLSYAHPSTAVKFFRWAGYQLNDRHSPYAWNLVVDMLGKNGLFDSMWDAIKSMQKERLLSLATFASVFGSYVKADQVKGAFMTFELMDQYGCVRDIVALNSLLSAICTDGKTLDAKEFLQVAKSQIRPDADTYAILLEGWENEQDAVNA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G478880`
TK1151 ID	TkA02G478880
OH-1004 ID	LXL04_013678
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 97.324 / OH-1004 59.259 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G478880

Location Chr02:122218566-122219801 (+)

Description Similar to At1g77360: Pentatricopeptide repeat-containing protein At1g77360, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g52640`	Pentatricopeptide repeat-containing protein At1g52640, mitochondrial.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013678 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006397 mRNA processing Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0003729 mRNA binding Molecular Function

KEGG gene cross-reference

ath:AT1G52640

ath:AT1G71060

ath:AT1G77360

ath:AT3G62470

ath:AT3G62540

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.465

Rank 1 · TkA02G478880 · TK1151

Mitochondrion0.368

Rank 2 · TkA02G478880 · TK1151

Nucleus0.094

Rank 3 · TkA02G478880 · TK1151

Cytoplasm0.036

Rank 4 · TkA02G478880 · TK1151

Cell membrane0.011

Rank 5 · TkA02G478880 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF29070MSC6_N43-253 aa

PF10037MRP-S2786-125 aa

PF13041PPR_2140-168 aa

PF01535PPR140-168 aa

PF12854PPR_1141-155 aa

PF23276TPR_24144-266 aa

PF17177PPR_long147-256 aa

PF13812PPR_3171-217 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G478880	`PF29070`	MSC6_N	43	253	4.9e-10	39.8
TkA02G478880	`PF10037`	MRP-S27	86	125	0.25	11.0
TkA02G478880	`PF13041`	PPR_2	140	168	8.9e-28	96.9
TkA02G478880	`PF01535`	PPR	140	168	7.3e-15	54.8
TkA02G478880	`PF12854`	PPR_1	141	155	5.8e-09	36.2
TkA02G478880	`PF23276`	TPR_24	144	266	3.8e-10	40.5
TkA02G478880	`PF17177`	PPR_long	147	256	3.8e-07	30.4
TkA02G478880	`PF13812`	PPR_3	171	217	5.7e-13	49.4
TkA02G478880	`PF13041`	PPR_2	173	205	8.9e-28	96.9
TkA02G478880	`PF01535`	PPR	174	203	7.3e-15	54.8
TkA02G478880	`PF10037`	MRP-S27	178	216	0.25	11.0
TkA02G478880	`PF12854`	PPR_1	184	198	5.8e-09	36.2
TkA02G478880	`PF13812`	PPR_3	198	249	5.7e-13	49.4
TkA02G478880	`PF12854`	PPR_1	202	230	5.8e-09	36.2
TkA02G478880	`PF13041`	PPR_2	205	250	8.9e-28	96.9
TkA02G478880	`PF01535`	PPR	208	231	7.3e-15	54.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SSR6`	Arabidopsis thaliana	sp\|Q9SSR6\|PPR78_ARATH Pentatricopeptide repeat-containing protein At1g52640, mitochondrial	25.400%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card