Gene Card
Gene overview
cDNA / CDS / Protein Sequences
2454 bp · TkA02G469830|TK1151|cDNA
CTTGAAACAAAATGACAATTCTGCCCTATCTTTAACCCTCCTGCAGATACGCATCTTTTCCATTGACTCACGACATCGATTTCTTGGCAAACCCCCAATCGACTTCCATTCTGCTTCCTAATTGTCTTTCTCCCATTGATATATGATTCGTACTCTCCCTCGAATTGATTTCTTCCATTGTCTTTCTCCCTTGACTAACGACATCGTCCTTTTCCATTCGATTCCAGCCATCGATATCTGTTGAATCTAATCTCAATCGG...
759 bp · TkA02G469830|TK1151|CDS
ATGATTTATCTTCATCACCTACGGATGTTATTTACGGTGGTCCGAATTACAGACCACCAACACCATCCCACCACCATAGCTATGATGATTACCATTTCCACTATCACTATCACCGCCATTCTCACCATCTCCTTCCCCATCTCCGCCAACATACTCCCATTCGCGGTTGCGGTCCGGACCGCCCCGGTCAGCATCCCCACAAGTCCCAGATACCTTTCTCCGAACCTCCATCTTCCACCACCATCACCTAGAAGCACTAC...
Protein
Download Protein FASTA252 aa · TkA02G469830|TK1151|PROTEIN
MIYLHHLRMLFTVVRITDHQHHPTTIAMMITISTITITAILTISFPISANILPFAVAVRTAPVSIPTSPRYLSPNLHLPPPSPRSTTRYDESPSGVRSLKKSDMSRVRDNKDDSGRFSGLLSSSGSPRVVFSRSSSSRLSLQDELLDDIDFSCPFIVDDVDTCDSPVSESGSGSVGGGKQGGKKSQDAAAVGALVRMLRTAPPLRQDSSCYSSSLEAQFNNSESASGCLWPEVHRMLWRSLRRIGILNILSL
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA02G469830 |
|---|---|
| TK1151 ID | TkA02G469830 |
| OH-1004 ID | LXL04_013820 |
| Relationship / confidence | Rbh Below Probable Coverage Or Synteny Threshold / Review |
| Protein identity (%) | 98.200 |
| Protein coverage (%) | TK1151 67.063 / OH-1004 30.249Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA02G469830 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr02:119876733-119879460 (-) | |||||||||
| Description | Similar to ATG13A: Autophagy-related protein 13a | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0000423 mitophagy Biological Process GO:0006914 autophagy Biological Process GO:0006974 DNA damage response Biological Process GO:0006995 cellular response to nitrogen starvation Biological Process GO:0015031 protein transport Biological Process GO:0034497 protein localization to phagophore assembly site Biological Process GO:0034727 piecemeal microautophagy of the nucleus Biological Process GO:0044010 single-species biofilm formation Biological Process GO:0000407 phagophore assembly site Cellular Component GO:0005634 nucleus Cellular Component GO:0005776 autophagosome Cellular Component GO:0005829 cytosol Cellular Component | |||||||||
| KEGG gene cross-reference | ath:AT3G18770 ath:AT3G49590 cal:CAALFM_CR02910WA yli:2907738 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
No result was found for this query.
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.