TkA02G445710 | RubberDandelionOmics

Gene overview

TkA02G445710

Reference: TK1151 Chr: Chr02 Coordinates: 113249936-113253394 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

858 bp · TkA02G445710|TK1151|cDNA

ATGATTCCATACCCTTTCGGGATTGGAAAATCCTGTTCTCAGGACAATTGGTACAATGTGGATTGTAACTCTTCAACTGCGTATCTATCTGCATTCAACAACATACAAGTGTTGGGTGTTAACATCGAAAGCCAAACAGTCACTGTTAATTTTTCCAAAATATCTGATTGCGAGAAGCCAGTCCAGAACAATTACAGTATTCTCCAAAGCACAACTCCATTTCGTCTTTCAACTTTCCATAACTTGTTCGTGGTTGAGGG...

CDS

Download CDS FASTA

858 bp · TkA02G445710|TK1151|CDS

ATGATTCCATACCCTTTCGGGATTGGAAAATCCTGTTCTCAGGACAATTGGTACAATGTGGATTGTAACTCTTCAACTGCGTATCTATCTGCATTCAACAACATACAAGTGTTGGGTGTTAACATCGAAAGCCAAACAGTCACTGTTAATTTTTCCAAAATATCTGATTGCGAGAAGCCAGTCCAGAACAATTACAGTATTCTCCAAAGCACAACTCCATTTCGTCTTTCAACTTTCCATAACTTGTTCGTGGTTGAGGG...

Protein

Download Protein FASTA

285 aa · TkA02G445710|TK1151|PROTEIN

MIPYPFGIGKSCSQDNWYNVDCNSSTAYLSAFNNIQVLGVNIESQTVTVNFSKISDCEKPVQNNYSILQSTTPFRLSTFHNLFVVEGCGSAAIMDEYGTVVSGCSTTCDNQTLSNNTNNCNGVGVSISMGSLFLTMMSYALYKLIKKTKAKRRKQRCFKRNGGLLLKQQEASDIGLVDKTIIFTSDELEKATDHFNENRILGRGAQGTVYKGMLPDGRIVAIKKSKLVDESQLEQFINEVVILSQVNHRNVVKLLGCCLE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G445710`
TK1151 ID	TkA02G445710
OH-1004 ID	LXL04_014237
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	71.200
Protein coverage (%)	TK1151 95.088 / OH-1004 47.309 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G445710

Location Chr02:113249936-113253394 (+)

Description Similar to WAKL2: Wall-associated receptor kinase-like 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g16150`	Serine/threonine-protein kinase that may function as a signaling receptor of extracellular matrix component.	No verified direct reference in this release
`At1g16110`	Serine/threonine-protein kinase that may function as a signaling receptor of extracellular matrix component.	No verified direct reference in this release
`At1g16130`	Serine/threonine-protein kinase that may function as a signaling receptor of extracellular matrix component.	No verified direct reference in this release
`At1g69730`	Serine/threonine-protein kinase that may function as a signaling receptor of extracellular matrix component.	No verified direct reference in this release
`At1g16120`	Serine/threonine-protein kinase that may function as a signaling receptor of extracellular matrix component.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014237 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0007166 cell surface receptor signaling pathway Biological Process

GO:0046777 protein autophosphorylation Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0005509 calcium ion binding Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0030247 polysaccharide binding Molecular Function

GO:0106310 protein serine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT1G16120

ath:AT1G16130

ath:AT1G16260

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.829

Rank 1 · TkA02G445710 · TK1151

Cytoplasm0.086

Rank 2 · TkA02G445710 · TK1151

Endoplasmic reticulum0.085

Rank 3 · TkA02G445710 · TK1151

Nucleus0.053

Rank 4 · TkA02G445710 · TK1151

Lysosome / Vacuole0.033

Rank 5 · TkA02G445710 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13947GUB_WAK_bind2-49 aa

PF13947GUB_WAK_bind73-77 aa

PF13947GUB_WAK_bind104-113 aa

PF29364TED6127-155 aa

PF00069Pkinase136-156 aa

PF00069Pkinase195-273 aa

PF07714PK_Tyr_Ser-Thr198-272 aa

PF29364TED6222-226 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G445710	`PF13947`	GUB_WAK_bind	2	49	1.1e-07	32.8
TkA02G445710	`PF13947`	GUB_WAK_bind	73	77	1.1e-07	32.8
TkA02G445710	`PF13947`	GUB_WAK_bind	104	113	1.1e-07	32.8
TkA02G445710	`PF29364`	TED6	127	155	0.059	14.0
TkA02G445710	`PF00069`	Pkinase	136	156	7.9e-13	49.1
TkA02G445710	`PF00069`	Pkinase	195	273	7.9e-13	49.1
TkA02G445710	`PF07714`	PK_Tyr_Ser-Thr	198	272	1.4e-12	48.2
TkA02G445710	`PF29364`	TED6	222	226	0.059	14.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9S9M2`	Arabidopsis thaliana	sp\|Q9S9M2\|WAKLD_ARATH Wall-associated receptor kinase-like 4	60.800%	Swiss-Prot	Medium
`Q8GXQ3`	Arabidopsis thaliana	sp\|Q8GXQ3\|WAKLF_ARATH Wall-associated receptor kinase-like 6	58.400%	Swiss-Prot	Medium
`Q7X8C5`	Arabidopsis thaliana	sp\|Q7X8C5\|WAKLB_ARATH Wall-associated receptor kinase-like 2	60.100%	Swiss-Prot	Medium
`Q9C9L5`	Arabidopsis thaliana	sp\|Q9C9L5\|WAKLH_ARATH Wall-associated receptor kinase-like 9	60.400%	Swiss-Prot	Medium
`Q9S9M5`	Arabidopsis thaliana	sp\|Q9S9M5\|WAKLA_ARATH Wall-associated receptor kinase-like 1	58.800%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card