TkA02G430340 | RubberDandelionOmics

Gene overview

TkA02G430340

Reference: TK1151 Chr: Chr02 Coordinates: 109305657-109306556 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

778 bp · TkA02G430340|TK1151|cDNA

CCCAAATCAAAAACCCTAGCTCCCACAGTTTTATAGCCTCTCTTGTATACGCCGACTCGATTTTGTGTGCCGTTTAGGATCGATCGAGAGAGTGAAAGATGCCGGCGGGACATGGATTACGGTCGAGGACTAGGGATCTTTTTGCAAGAGGATTCAGGAAGAAGGGTACCATTCATCTATCCACCTACCTCAGAACCTACCACGTCGGCGATTATGTCGATATCAAGGTGAACGGCGCCGTTCATAAAGGTATGCCCCAC...

CDS

Download CDS FASTA

495 bp · TkA02G430340|TK1151|CDS

ATGCCGGCGGGACATGGATTACGGTCGAGGACTAGGGATCTTTTTGCAAGAGGATTCAGGAAGAAGGGTACCATTCATCTATCCACCTACCTCAGAACCTACCACGTCGGCGATTATGTCGATATCAAGGTGAACGGCGCCGTTCATAAAGGTATGCCCCACAAGTTCTACCATGGCCGCACCGGTCAGGTCTGGAACGTCACCAAGCGCGCCATCGGCGTCGAAATGAACAAACAGGTTGGTAACAGAATCATCAAGAA...

Protein

Download Protein FASTA

164 aa · TkA02G430340|TK1151|PROTEIN

MPAGHGLRSRTRDLFARGFRKKGTIHLSTYLRTYHVGDYVDIKVNGAVHKGMPHKFYHGRTGQVWNVTKRAIGVEMNKQVGNRIIKKRIHVRIEHVMPSRCTEEFKQRVKKNDQLKAEAKAKGVVISTKRQPLGPKPGFMVEGTTLETVTPIPYDVVNDLKGGY

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G430340`
TK1151 ID	TkA02G430340
OH-1004 ID	LXL04_014392
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G430340

Location Chr02:109305657-109306556 (-)

Description Similar to RPL21A: 60S ribosomal protein L21-1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`UniProt: Q43291`	Large ribosomal subunit protein eL21z/eL21y.	No verified direct reference in this release
`UniProt: Q9FDZ9`	Large ribosomal subunit protein eL21x/eL21w.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014392 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0002181 cytoplasmic translation Biological Process

GO:0006412 translation Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005840 ribosome Cellular Component

GO:0022625 cytosolic large ribosomal subunit Cellular Component

GO:0022626 cytosolic ribosome Cellular Component

GO:1990904 ribonucleoprotein complex Cellular Component

GO:0003735 structural constituent of ribosome Molecular Function

KEGG gene cross-reference

ath:AT1G09590

ath:AT1G09690

ath:AT1G57660

ath:AT1G57860

sce:YBR191W

sce:YPL079W

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.904

Rank 1 · TkA02G430340 · TK1151

Nucleus0.199

Rank 2 · TkA02G430340 · TK1151

Endoplasmic reticulum0.097

Rank 3 · TkA02G430340 · TK1151

Mitochondrion0.024

Rank 4 · TkA02G430340 · TK1151

Cell membrane0.014

Rank 5 · TkA02G430340 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01157Ribosomal_L21e1-101 aa

PF26460DUF813933-79 aa

PF05889SepSecS43-91 aa

PF01157Ribosomal_L21e112-124 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G430340	`PF01157`	Ribosomal_L21e	1	101	6.3e-45	151.9
TkA02G430340	`PF26460`	DUF8139	33	79	0.005	17.4
TkA02G430340	`PF05889`	SepSecS	43	91	0.099	12.1
TkA02G430340	`PF01157`	Ribosomal_L21e	112	124	6.3e-45	151.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q43291`	Arabidopsis thaliana	sp\|Q43291\|RL211_ARATH Large ribosomal subunit protein eL21z/eL21y	82.900%	Swiss-Prot	High
`Q9FDZ9`	Arabidopsis thaliana	sp\|Q9FDZ9\|RL212_ARATH Large ribosomal subunit protein eL21x/eL21w	82.300%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card