TkA02G418400 | RubberDandelionOmics

Gene overview

TkA02G418400

Reference: TK1151 Chr: Chr02 Coordinates: 106340717-106341263 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

381 bp · TkA02G418400|TK1151|cDNA

GAACTAGTAGAAGAAGGCAAGATAAAATACATAGGTCTCTCTGAAGCTTCACCAGAAACTATTAGACGTGCGCATAAAGTTCATCCGATAACAGCTGTTCAATTAGAATGGTCATTGTGGACAAGAGATGCTGAAGAAGAAGTCATTCCTACTTGCAGAGAACTTGGAATTGGGATAGTTCCGTTTAGTCCTCTAGGAAAGAGATTATTTTCATCGGGTCCAAAGGTGGTTGAGAATTTTGCTAGCAATGACTTCCGAAA...

CDS

Download CDS FASTA

381 bp · TkA02G418400|TK1151|CDS

GAACTAGTAGAAGAAGGCAAGATAAAATACATAGGTCTCTCTGAAGCTTCACCAGAAACTATTAGACGTGCGCATAAAGTTCATCCGATAACAGCTGTTCAATTAGAATGGTCATTGTGGACAAGAGATGCTGAAGAAGAAGTCATTCCTACTTGCAGAGAACTTGGAATTGGGATAGTTCCGTTTAGTCCTCTAGGAAAGAGATTATTTTCATCGGGTCCAAAGGTGGTTGAGAATTTTGCTAGCAATGACTTCCGAAA...

Protein

Download Protein FASTA

127 aa · TkA02G418400|TK1151|PROTEIN

ELVEEGKIKYIGLSEASPETIRRAHKVHPITAVQLEWSLWTRDAEEEVIPTCRELGIGIVPFSPLGKRLFSSGPKVVENFASNDFRKGENLEHNKIVYERVNDMARKKGCTPSQLALTWLLHQGDDV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G418400`
TK1151 ID	TkA02G418400
OH-1004 ID	LXL04_014502
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	94.700
Protein coverage (%)	TK1151 100.000 / OH-1004 43.464 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G418400

Location Chr02:106340717-106341263 (-)

Description Similar to At1g60690: Probable aldo-keto reductase 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g60690`	Probable aldo-keto reductase 3.	No verified direct reference in this release
`At1g60710`	Probable aldo-keto reductase 4.	No verified direct reference in this release
`At1g60730`	Probable aldo-keto reductase 5.	No verified direct reference in this release
`At1g60680`	Probable aldo-keto reductase 2.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014502 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009941 chloroplast envelope Cellular Component

GO:0008106 alcohol dehydrogenase (NADP+) activity Molecular Function

GO:0016491 oxidoreductase activity Molecular Function

KEGG gene cross-reference

ath:AT1G60690

ath:AT1G60710

ath:AT1G60730

dosa:Os04g0338000

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.619

Rank 1 · TkA02G418400 · TK1151

Nucleus0.261

Rank 2 · TkA02G418400 · TK1151

Plastid0.143

Rank 3 · TkA02G418400 · TK1151

Peroxisome0.103

Rank 4 · TkA02G418400 · TK1151

Mitochondrion0.051

Rank 5 · TkA02G418400 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00248Aldo_ket_red1-123 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G418400	`PF00248`	Aldo_ket_red	1	123	5.7e-26	92.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O22707`	Arabidopsis thaliana	sp\|O22707\|ALKR3_ARATH Probable aldo-keto reductase 3	73.500%	Swiss-Prot	High
`Q93ZN2`	Arabidopsis thaliana	sp\|Q93ZN2\|ALKR4_ARATH Probable aldo-keto reductase 4	73.500%	Swiss-Prot	High
`Q9ASZ9`	Arabidopsis thaliana	sp\|Q9ASZ9\|ALKR5_ARATH Probable aldo-keto reductase 5	70.500%	Swiss-Prot	High
`Q84M96`	Arabidopsis thaliana	sp\|Q84M96\|ALKR2_ARATH Probable aldo-keto reductase 2	68.900%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card