TkA02G399360 | RubberDandelionOmics

Gene overview

TkA02G399360

Reference: TK1151 Chr: Chr02 Coordinates: 101426119-101427802 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1105 bp · TkA02G399360|TK1151|cDNA

GAGTCTTTGAAGGGGAAATAGTAGCTAGCTAGCTAGGTAGAGACATGGGAAGGCCACCATGCTGTGATAAGGTTGGCGTCAAGAAAGGCCCATGGACCCCTGAAGAAGACATCATTTTGGTCTCTTACATTCAAGAACATGGTCCTGGAAATTGGAGATCAGTGCCTACCAACACTGGTCTTTTAAGATGCAGCAAGAGTTGCAGACTAAGATGGACTAATTATCTAAGGCCAGGTATCAAAAGGGGCAACTTCACTCCA...

CDS

Download CDS FASTA

855 bp · TkA02G399360|TK1151|CDS

ATGGGAAGGCCACCATGCTGTGATAAGGTTGGCGTCAAGAAAGGCCCATGGACCCCTGAAGAAGACATCATTTTGGTCTCTTACATTCAAGAACATGGTCCTGGAAATTGGAGATCAGTGCCTACCAACACTGGTCTTTTAAGATGCAGCAAGAGTTGCAGACTAAGATGGACTAATTATCTAAGGCCAGGTATCAAAAGGGGCAACTTCACTCCACATGAAGAAGGGATGATAGTTCACCTCCAAGCATTATTGGGTAA...

Protein

Download Protein FASTA

284 aa · TkA02G399360|TK1151|PROTEIN

MGRPPCCDKVGVKKGPWTPEEDIILVSYIQEHGPGNWRSVPTNTGLLRCSKSCRLRWTNYLRPGIKRGNFTPHEEGMIVHLQALLGNKWAAIASYLPQRTDNDIKNYWNTHLKKKIKNLQMSTSDTTTCIDVSISKLSSGNTHQNTMVTTTKNPHQCPNMYASSTQNISRLLEGWMRSSSSNNLEEKLAKQENGKECFNGLVESVDFEFESDLSFDNGCWDKMMNVDYYQKGGDSNEDKGACIFNERKYQKQESLSKPPL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G399360`
TK1151 ID	TkA02G399360
OH-1004 ID	LXL04_014760
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.900
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G399360

Location Chr02:101426119-101427802 (-)

Description Similar to MYB60: Transcription factor MYB60

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g08810`	Transcription factor involved in the regulation of gene (e.g. drought-regulated and flavonoid biosynthetic genes) expression and stomatal movements leading to negative regulation of responses to drought and responses to other physiological stimuli (e.g. light).	A guard-cell-specific MYB transcription factor regulates stomatal movements and plant drought tolerance.2005 · DOI: 10.1016/j.cub.2005.05.048 A dual role for MYB60 in stomatal regulation and root growth of Arabidopsis thaliana under drought stress.2011 · DOI: 10.1007/s11103-011-9796-7
`At3g47600`	Transcription activator involved in the activation of cuticular wax biosynthesis under drought stress.	Cuticular wax biosynthesis is up-regulated by the MYB94 transcription factor in Arabidopsis.2015 · DOI: 10.1093/pcp/pcu142 MYB94 and MYB96 Additively Activate Cuticular Wax Biosynthesis in Arabidopsis.2016 · DOI: 10.1093/pcp/pcw147

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014760 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006952 defense response Biological Process

GO:0009409 response to cold Biological Process

GO:0009411 response to UV Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009416 response to light stimulus Biological Process

GO:0009637 response to blue light Biological Process

GO:0009646 response to absence of light Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009733 response to auxin Biological Process

GO:0009737 response to abscisic acid Biological Process

KEGG gene cross-reference

ath:AT1G08810

ath:AT5G62470

vvi:100233072

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.953

Rank 1 · TkA02G399360 · TK1151

Cytoplasm0.110

Rank 2 · TkA02G399360 · TK1151

Cell membrane0.024

Rank 3 · TkA02G399360 · TK1151

Plastid0.012

Rank 4 · TkA02G399360 · TK1151

Endoplasmic reticulum0.012

Rank 5 · TkA02G399360 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00249Myb_DNA-binding14-61 aa

PF13921Myb_DNA-bind_617-75 aa

PF23588HTH_CHD1_Hrp317-42 aa

PF00249Myb_DNA-binding67-112 aa

PF13921Myb_DNA-bind_671-122 aa

PF15963Myb_DNA-bind_785-133 aa

PF23588HTH_CHD1_Hrp3217-224 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G399360	`PF00249`	Myb_DNA-binding	14	61	2.3e-33	114.7
TkA02G399360	`PF13921`	Myb_DNA-bind_6	17	75	1.2e-19	70.9
TkA02G399360	`PF23588`	HTH_CHD1_Hrp3	17	42	0.036	14.8
TkA02G399360	`PF00249`	Myb_DNA-binding	67	112	2.3e-33	114.7
TkA02G399360	`PF13921`	Myb_DNA-bind_6	71	122	1.2e-19	70.9
TkA02G399360	`PF15963`	Myb_DNA-bind_7	85	133	0.033	14.7
TkA02G399360	`PF23588`	HTH_CHD1_Hrp3	217	224	0.036	14.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8GYP5`	Arabidopsis thaliana	sp\|Q8GYP5\|MYB60_ARATH Transcription factor MYB60	53.400%	Swiss-Prot	High
`Q9SN78`	Arabidopsis thaliana	sp\|Q9SN78\|MYB94_ARATH Transcription factor MYB94	87.300%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card