TkA02G391920 | RubberDandelionOmics

Gene overview

TkA02G391920

Reference: TK1151 Chr: Chr02 Coordinates: 99594883-99598295 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1543 bp · TkA02G391920|TK1151|cDNA

ATTTGTCCCAGCTACCAGTGGGAGTAAATAACGACAGTTAGAATTTTTGTAGCTCCCACTAGAAATATTTTCATGTTGTGAATAACTTTGTCTCTGCTGATCTCGTTCATGTCTCTTTGTGATTTTGCAGTTAAACACTTTGCGTGATTTCCATATTCGAAATCTATTACAGTTTGCAAGCTTCATATGACTAATTCTGTTGATAATGATAGAGTACAGTTATTTTTAGGAGACTATTGGTCTGACATACCGTTTGAAAG...

CDS

Download CDS FASTA

1182 bp · TkA02G391920|TK1151|CDS

ATGACTAATTCTGTTGATAATGATAGAGTACAGTTATTTTTAGGAGACTATTGGTCTGACATACCGTTTGAAAGGCCGTCTACAAATTCTCCCCGTCGGAAATTTATCGACTCGTTAATTTGGTGGGGAAGAGATATGGAGTATTTTAAGCTTCGAATCTTATTAATTTTTCTTCTTGTCGCCGAGATCAATGGCGAACCTATAGTTCCGGCGTTATGCTTCTTCGGTGACTCTGTAATGGACGCCGGAAACAACAATCA...

Protein

Download Protein FASTA

393 aa · TkA02G391920|TK1151|PROTEIN

MTNSVDNDRVQLFLGDYWSDIPFERPSTNSPRRKFIDSLIWWGRDMEYFKLRILLIFLLVAEINGEPIVPALCFFGDSVMDAGNNNHLTTLLRANFLPYGRDFIDHKPTGRFCNGKLAADYTAEFLGFDTYPPPYLSRIDNESLLLTGANFASAGSGYYDETALIYQALSLRRQLSHYKDWQNRVVAMVGGEKAKEIFATGIHILSAGSSDFLQNYDINPVLNRIYSPPQFSDILITSYITFVEGLYDVGVRRFGVISLP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G391920`
TK1151 ID	TkA02G391920
OH-1004 ID	LXL04_014853
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.200
Protein coverage (%)	TK1151 90.331 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G391920

Location Chr02:99594883-99598295 (-)

Description Similar to At5g03810: GDSL esterase/lipase At5g03810

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g03820`	GDSL esterase/lipase At5g03820.	No verified direct reference in this release
`At5g03810`	GDSL esterase/lipase At5g03810.	No verified direct reference in this release
`At3g53100`	GDSL esterase/lipase At3g53100.	No verified direct reference in this release
`At5g22810`	GDSL esterase/lipase At5g22810.	No verified direct reference in this release
`At3g16370`	GDSL esterase/lipase APG.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014853 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0016042 lipid catabolic process Biological Process

GO:0005576 extracellular region Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0048046 apoplast Cellular Component

GO:0016298 lipase activity Molecular Function

GO:0016788 hydrolase activity, acting on ester bonds Molecular Function

KEGG gene cross-reference

ath:AT3G16370

ath:AT3G53100

ath:AT5G03810

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.307

Rank 1 · TkA02G391920 · TK1151

Lysosome / Vacuole0.281

Rank 2 · TkA02G391920 · TK1151

Endoplasmic reticulum0.124

Rank 3 · TkA02G391920 · TK1151

Cytoplasm0.096

Rank 4 · TkA02G391920 · TK1151

Cell membrane0.089

Rank 5 · TkA02G391920 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00657Lipase_GDSL74-383 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G391920	`PF00657`	Lipase_GDSL	74	383	7.3e-30	105.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LZC5`	Arabidopsis thaliana	sp\|Q9LZC5\|GDL73_ARATH GDSL esterase/lipase At5g03820	62.000%	Swiss-Prot	High
`Q9FFN0`	Arabidopsis thaliana	sp\|Q9FFN0\|GDL72_ARATH GDSL esterase/lipase At5g03810	62.200%	Swiss-Prot	High
`Q0WPI9`	Arabidopsis thaliana	sp\|Q0WPI9\|GDL59_ARATH GDSL esterase/lipase At3g53100	58.600%	Swiss-Prot	High
`Q9FFC6`	Arabidopsis thaliana	sp\|Q9FFC6\|GDL78_ARATH GDSL esterase/lipase At5g22810	53.500%	Swiss-Prot	High
`Q9LU14`	Arabidopsis thaliana	sp\|Q9LU14\|APG2_ARATH GDSL esterase/lipase APG	51.900%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card