TkA02G380490 | RubberDandelionOmics

Gene overview

TkA02G380490

Reference: TK1151 Chr: Chr02 Coordinates: 96725324-96730424 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2541 bp · TkA02G380490|TK1151|cDNA

AGAACCGATTACACCAAGAGGTAACTTCATGCTACCAACTCGACGTGTTCCATAAATGAAACCAGGCCTCAAAATCACATCTGAAAGAAAAAAAAAAGGTAAATGTTATAGAAAATAAAATGTACATGTTTTAGGAAAAAAGGGGAAATAAAAACAATACTCAGACTCAGACCACGGACTCGGTCCGTGGTCCGAGCGTTTGATAGCGTGCATGTGATGTCAGACCACGGACTCGGTCCGACCTTTTGCCTCGGACTCGG...

CDS

Download CDS FASTA

1518 bp · TkA02G380490|TK1151|CDS

ATGGGTAGAATTACAGTTGCATTGATTGTTACCTCATGGGTAATACCAATTTCCATCCTTGTCAACCGCATTGTTCCCGAACCATACATGGATGAAATCTTTCATGTCCCTCAAGCCCAACAATACTGTATAGGCAACTTCAAAAGCTGGGATCCAATGATAACCACTCCACCTGGACTGTACTTCATTTCACTTGCATATATATCTTCTTTATTTCCTGGGATCAAATTAATACAACAAATCTCAAATTTTATTGATGT...

Protein

Download Protein FASTA

505 aa · TkA02G380490|TK1151|PROTEIN

MGRITVALIVTSWVIPISILVNRIVPEPYMDEIFHVPQAQQYCIGNFKSWDPMITTPPGLYFISLAYISSLFPGIKLIQQISNFIDVCSISVLRSTNGLLAVICSILVHDIIKSLKPSIDDKKATFYAVIVALYPLHWFFTFLYYTDVASVTVVLAMYLMCLKKKYMCSALFGGVTVVIRQTNIIWMLFVACTGILNIIQHKKEIHEKEYLSSDPKNDHFASSSSVDNISSSLKRRRSGNAVDHGKKSLPSLPDRSTGLF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G380490`
TK1151 ID	TkA02G380490
OH-1004 ID	LXL04_014963
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.200
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G380490

Location Chr02:96725324-96730424 (+)

Description Similar to ALG10: Dol-P-Glc:Glc(2)Man(9)GlcNAc(2)-PP-Dol alpha-1,2-glucosyltransferase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g02410`	May catalyze glucosyl transfer during biosynthesis of protein N-glycosylation precursors.	Arabidopsis thaliana alpha1,2-glucosyltransferase (ALG10) is required for efficient N-glycosylation and leaf growth.2011 · DOI: 10.1111/j.1365-313x.2011.04688.x

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014963 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006487 protein N-linked glycosylation Biological Process

GO:0006488 dolichol-linked oligosaccharide biosynthetic process Biological Process

GO:0009651 response to salt stress Biological Process

GO:0048366 leaf development Biological Process

GO:0071805 potassium ion transmembrane transport Biological Process

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0098553 lumenal side of endoplasmic reticulum membrane Cellular Component

GO:0046527 glucosyltransferase activity Molecular Function

GO:0106073 dolichyl pyrophosphate Glc2Man9GlcNAc2 alpha-1,2-glucosyltransferase activity Molecular Function

KEGG gene cross-reference

ath:AT5G02410

hsa:144245

hsa:84920

mmu:380959

rno:245960

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.864

Rank 1 · TkA02G380490 · TK1151

Nucleus0.075

Rank 2 · TkA02G380490 · TK1151

Cytoplasm0.056

Rank 3 · TkA02G380490 · TK1151

Golgi apparatus0.053

Rank 4 · TkA02G380490 · TK1151

Cell membrane0.044

Rank 5 · TkA02G380490 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04922DIE2_ALG1025-458 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G380490	`PF04922`	DIE2_ALG10	25	458	1.9e-126	423.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8L638`	Arabidopsis thaliana	sp\|Q8L638\|ALG10_ARATH Dol-P-Glc:Glc(2)Man(9)GlcNAc(2)-PP-Dol alpha-1,2-glucosyltransferase	54.900%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card