TkA02G379230 | RubberDandelionOmics

Gene overview

TkA02G379230

Reference: TK1151 Chr: Chr02 Coordinates: 96430875-96432426 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1054 bp · TkA02G379230|TK1151|cDNA

ATTTTATATTATTATGAAACAATATATATAATATAATGATTTAGGAGATAACAACTATTGTGATAAACTTAAATAAAAGCCCCAAAAAACTTTAGCTTATAAATATAATTCCAAAGTAGAATCATTCTATCTTCATTACAAAGCATATACACCCCTTTACTCTATAACTAACCCATCATATTATTCCCGATCCCATTGCAATTTCTCAATCACCATCACCACCTGTCTACCACCATCGCCATCATAAATCTAATCGATGA...

CDS

Download CDS FASTA

579 bp · TkA02G379230|TK1151|CDS

ATGAAAGATCGAATGGAACGTTTTATCGCGTTTCCCTTTGCCACGGGGTGTGTCTCCGCCTCTAGTGTCGTAGTTTCTGGACAACACAATAGAAGATCAAAGGAAGACATTGACTCGCCTCACACAGTGTGTAGATCATATAGCCTTCCAAAGGATCCGAAATATGAAGATGGAACACCCATATCGAGCGACAACATGACAAAGAGCTCATTTCGATTCACGGCGCTTTCAAAGCCTATTGTATCTGTTGCACTCCACCG...

Protein

Download Protein FASTA

192 aa · TkA02G379230|TK1151|PROTEIN

MKDRMERFIAFPFATGCVSASSVVVSGQHNRRSKEDIDSPHTVCRSYSLPKDPKYEDGTPISSDNMTKSSFRFTALSKPIVSVALHRLTRGIKSISQSLAFKEENETQMEMEIGLPTDVKHVAHVGFDGSVTSEVNRPRSLSNTDYLGFCPVSFAQLEGRLAMCAPLDASRDTKNTLPNAKRARNKTETSMV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G379230`
TK1151 ID	TkA02G379230
OH-1004 ID	LXL04_014979
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G379230

Location Chr02:96430875-96432426 (+)

Description Similar to RIC4: CRIB domain-containing protein RIC4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g16490`	Functions as a downstream effector of Rho-related GTP binding proteins of the 'Rho of Plants' (ROPs) family.	A genome-wide analysis of Arabidopsis Rop-interactive CRIB motif-containing proteins that act as Rop GTPase targets.2001 · DOI: 10.1105/tpc.010218 Arabidopsis interdigitating cell growth requires two antagonistic pathways with opposing action on cell morphogenesis.2005 · DOI: 10.1016/j.cell.2004.12.026 A Rho family GTPase controls actin dynamics and tip growth via two counteracting downstream pathways in pollen tubes.2005 · DOI: 10.1083/jcb.200409140 Arabidopsis ROP1 and ROP6 influence germination time, root morphology, the formation of F-actin bundles, and symbiotic fungal interactions.2013 · DOI: 10.1093/mp/sss101
`At1g27380`	Functions as a downstream effector of Rho-related GTP binding proteins of the 'Rho of Plants' (ROPs) family.	No verified direct reference in this release
`At4g04900`	Functions as a downstream effector of Rho-related GTP binding proteins of the 'Rho of Plants' (ROPs) family.	A genome-wide analysis of Arabidopsis Rop-interactive CRIB motif-containing proteins that act as Rop GTPase targets.2001 · DOI: 10.1105/tpc.010218
`At4g28556`	Functions as a downstream effector of Rho-related GTP binding proteins of the 'Rho of Plants' (ROPs) family.	No verified direct reference in this release
`At1g03982`	Functions as a downstream effector of Rho-related GTP binding proteins of the 'Rho of Plants' (ROPs) family.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014979 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009416 response to light stimulus Biological Process

GO:0009860 pollen tube growth Biological Process

GO:0010215 cellulose microfibril organization Biological Process

GO:0017157 regulation of exocytosis Biological Process

GO:0030833 regulation of actin filament polymerization Biological Process

GO:0051650 establishment of vesicle localization Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016324 apical plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT1G03982

ath:AT2G20430

ath:AT4G04900

ath:AT4G28556

ath:AT5G16490

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.380

Rank 1 · TkA02G379230 · TK1151

Nucleus0.323

Rank 2 · TkA02G379230 · TK1151

Mitochondrion0.200

Rank 3 · TkA02G379230 · TK1151

Cell membrane0.148

Rank 4 · TkA02G379230 · TK1151

Endoplasmic reticulum0.080

Rank 5 · TkA02G379230 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12018FAP20684-159 aa

PF00786PBD112-132 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G379230	`PF12018`	FAP206	84	159	0.097	12.7
TkA02G379230	`PF00786`	PBD	112	132	2.9e-05	25.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FFD5`	Arabidopsis thaliana	sp\|Q9FFD5\|RIC4_ARATH CRIB domain-containing protein RIC4	36.800%	Swiss-Prot	Medium
`Q8GYU0`	Arabidopsis thaliana	sp\|Q8GYU0\|RIC2_ARATH CRIB domain-containing protein RIC2	43.500%	Swiss-Prot	Low
`Q9M0Y9`	Arabidopsis thaliana	sp\|Q9M0Y9\|RIC10_ARATH CRIB domain-containing protein RIC10	48.000%	Swiss-Prot	Low
`Q1G3K8`	Arabidopsis thaliana	sp\|Q1G3K8\|RIC7_ARATH CRIB domain-containing protein RIC7	52.100%	Swiss-Prot	Low
`Q9ZWB8`	Arabidopsis thaliana	sp\|Q9ZWB8\|RIC8_ARATH CRIB domain-containing protein RIC8	38.400%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card