TkA02G369820 | RubberDandelionOmics

Gene overview

TkA02G369820

Reference: TK1151 Chr: Chr02 Coordinates: 94112269-94117533 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2964 bp · TkA02G369820|TK1151|cDNA

GTTTTATGGACCAAACACCACGGATTGCCGGATACAAATACATTTGGTGTCGAATCAAATTTCAAACGTACCTTTTCCCGGTTAATATATTTCAAGGGTTCTGCTTTCCGCCGATCACTGAGAACCGGGAGCAAAATGGAGATCAAGAGTCCGGCACCTTGCCCTAAAACCGTCACCGTCCGGAGAAACCCTCCCCGGCGAGCCAGACCTACTCCTTCCACCGTCGTCCCCATCTCAGCAGCTCCATCTTCTAAAACATC...

CDS

Download CDS FASTA

2805 bp · TkA02G369820|TK1151|CDS

GTTTTATGGACCAAACACCACGGATTGCCGGATACAAATACATTTGGTGTCGAATCAAATTTCAAACGTACCTTTTCCCGGTTAATATATTTCAAGGGTTCTGCTTTCCGCCGATCACTGAGAACCGGGAGCAAAATGGAGATCAAGAGTCCGGCACCTTGCCCTAAAACCGTCACCGTCCGGAGAAACCCTCCCCGGCGAGCCAGACCTACTCCTTCCACCGTCGTCCCCATCTCAGCAGCTCCATCTTCTAAAACATC...

Protein

Download Protein FASTA

934 aa · TkA02G369820|TK1151|PROTEIN

VLWTKHHGLPDTNTFGVESNFKRTFSRLIYFKGSAFRRSLRTGSKMEIKSPAPCPKTVTVRRNPPRRARPTPSTVVPISAAPSSKTSSAIRSFPIHDILSIDIPEKEKEKQEIPEPSSPKEPSSSEKLKVFLRIKPIITQPKVGVSVKNAAHKNVWPQNPSKKKDASKTAKAVGKKSNEICLKVNDSHSVTLCPPQSLADARRTKSEVYEGFSHVFCADSSQSDVYDKMVNPLVDDFLNGKSGMIAAMGPSGSGKTHTVF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G369820`
TK1151 ID	TkA02G369820
OH-1004 ID	LXL04_015091
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	91.400
Protein coverage (%)	TK1151 100.000 / OH-1004 92.553 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G369820

Location Chr02:94112269-94117533 (+)

Description Similar to KIN6: Kinesin-like protein KIN-6

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g20060`	Kinesin-like protein KIN-6.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0101800`	Kinesin-like protein KIN-6.	No verified direct reference in this release
`Os11g0552600`	Kinesin-like protein KIN-7L.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_015091 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000022 mitotic spindle elongation Biological Process

GO:0000070 mitotic sister chromatid segregation Biological Process

GO:0000226 microtubule cytoskeleton organization Biological Process

GO:0000278 mitotic cell cycle Biological Process

GO:0007018 microtubule-based movement Biological Process

GO:0007019 microtubule depolymerization Biological Process

GO:0007052 mitotic spindle organization Biological Process

GO:0007079 mitotic chromosome movement towards spindle pole Biological Process

GO:0008608 attachment of spindle microtubules to kinetochore Biological Process

GO:0010970 transport along microtubule Biological Process

GO:0030705 cytoskeleton-dependent intracellular transport Biological Process

GO:0033044 regulation of chromosome organization Biological Process

KEGG gene cross-reference

ath:AT1G20060

dosa:Os02g0101800

dosa:Os11g0552600

gla:GL50803_0016456

osa:4327984

spo:2540361

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.788

Rank 1 · TkA02G369820 · TK1151

Cytoplasm0.224

Rank 2 · TkA02G369820 · TK1151

Cell membrane0.059

Rank 3 · TkA02G369820 · TK1151

Endoplasmic reticulum0.029

Rank 4 · TkA02G369820 · TK1151

Golgi apparatus0.015

Rank 5 · TkA02G369820 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF16796Microtub_bd179-301 aa

PF00225Kinesin199-496 aa

PF16796Microtub_bd522-569 aa

PF27293AF_1575645-716 aa

PF00225Kinesin794-827 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G369820	`PF16796`	Microtub_bd	179	301	2.5e-10	41.2
TkA02G369820	`PF00225`	Kinesin	199	496	6.6e-53	180.5
TkA02G369820	`PF16796`	Microtub_bd	522	569	2.5e-10	41.2
TkA02G369820	`PF27293`	AF_1575	645	716	0.032	14.8
TkA02G369820	`PF00225`	Kinesin	794	827	6.6e-53	180.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4HR11`	Arabidopsis thaliana	sp\|F4HR11\|KN6_ARATH Kinesin-like protein KIN-6	50.100%	Swiss-Prot	High
`Q6YU88`	Oryza sativa subsp. japonica	sp\|Q6YU88\|KN6_ORYSJ Kinesin-like protein KIN-6	45.100%	Swiss-Prot	Medium
`Q2R2P7`	Oryza sativa subsp. japonica	sp\|Q2R2P7\|KN7L_ORYSJ Kinesin-like protein KIN-7L	33.600%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card