TkA02G337000 | RubberDandelionOmics

Gene overview

TkA02G337000

Reference: TK1151 Chr: Chr02 Coordinates: 85552422-85555249 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1470 bp · TkA02G337000|TK1151|cDNA

ATGAATTCCACAGCGACAGATGGTGGTGGTCTTGCGAAACAATGGCGGACTGGTGCTGGTCGGAACGAACGCACACACACAGCACACCCGCATGTCTTCCTCTCTCTCTCTAACCCGAGAATCTGTCTCGTCGTTCCTCGACTCCGGAGGGTTAGGGTTCGAATAGAAAAGAAGAAGCTGAAAGATTTATTGAAATCAATTCCCAATATTAGTGTGACCACAGATATGTGGAAGTCTACTAATCAGAAAATCGAGTATAT...

CDS

Download CDS FASTA

1470 bp · TkA02G337000|TK1151|CDS

ATGAATTCCACAGCGACAGATGGTGGTGGTCTTGCGAAACAATGGCGGACTGGTGCTGGTCGGAACGAACGCACACACACAGCACACCCGCATGTCTTCCTCTCTCTCTCTAACCCGAGAATCTGTCTCGTCGTTCCTCGACTCCGGAGGGTTAGGGTTCGAATAGAAAAGAAGAAGCTGAAAGATTTATTGAAATCAATTCCCAATATTAGTGTGACCACAGATATGTGGAAGTCTACTAATCAGAAAATCGAGTATAT...

Protein

Download Protein FASTA

489 aa · TkA02G337000|TK1151|PROTEIN

MNSTATDGGGLAKQWRTGAGRNERTHTAHPHVFLSLSNPRICLVVPRLRRVRVRIEKKKLKDLLKSIPNISVTTDMWKSTNQKIEYMVLIGHFVDSYWNLQKRVLSFVHLPRGLEISDNLYKCLKDWGIENKIFTISVDNASNNDSAVKILSETFSRVKKLPCRGKLFHMLSAAIKFKDVFPMYKEREPRYQCCPTNEDWLKVEKVCAILEVFNSATNIISGSEYPTSNLFLNEVFRIKVLLDKNFQDPNEDEFVHDMVW...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G337000`
TK1151 ID	TkA02G337000
OH-1004 ID	LXL04_034848
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	67.000
Protein coverage (%)	TK1151 88.957 / OH-1004 75.103 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G337000

Location Chr02:85552422-85555249 (+)

Description Similar to Os03g0733400: Zinc finger BED domain-containing protein RICESLEEPER 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g42170`	Transposase-like protein that is essential for plant growth and development.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0733400`	Transposase-like protein that is essential for plant growth and development.	No verified direct reference in this release
`Os05g0239150`	Transposase-like protein that is essential for plant growth and development.	No verified direct reference in this release
`Os05g0583200`	Transposase-like protein that is essential for plant growth and development.	No verified direct reference in this release
`Os01g0518400`	Transposase-like protein that is essential for plant growth and development.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_034848 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006310 DNA recombination Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0009791 post-embryonic development Biological Process

GO:0032196 transposition Biological Process

GO:0005634 nucleus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0003677 DNA binding Molecular Function

GO:0008270 zinc ion binding Molecular Function

GO:0046983 protein dimerization activity Molecular Function

KEGG gene cross-reference

ath:AT3G42170

dosa:Os03g0733400

dosa:Os05g0239150

dosa:Os05g0583200

osa:4339741

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.682

Rank 1 · TkA02G337000 · TK1151

Cytoplasm0.376

Rank 2 · TkA02G337000 · TK1151

Mitochondrion0.035

Rank 3 · TkA02G337000 · TK1151

Endoplasmic reticulum0.026

Rank 4 · TkA02G337000 · TK1151

Cell membrane0.023

Rank 5 · TkA02G337000 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04937DUF65969-171 aa

PF27041ZBED1_RNase-like73-167 aa

PF20958GxGYxYP_N_3rd122-163 aa

PF27039ZBED1_RNase-like_helical168-208 aa

PF14372hAT-like_RNase-H229-306 aa

PF05699Dimer_Tnp_hAT343-412 aa

PF14372hAT-like_RNase-H434-449 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G337000	`PF04937`	DUF659	69	171	0.048	14.0
TkA02G337000	`PF27041`	ZBED1_RNase-like	73	167	7.5e-26	90.8
TkA02G337000	`PF20958`	GxGYxYP_N_3rd	122	163	0.027	15.3
TkA02G337000	`PF27039`	ZBED1_RNase-like_helical	168	208	0.00026	21.7
TkA02G337000	`PF14372`	hAT-like_RNase-H	229	306	1.4e-22	80.4
TkA02G337000	`PF05699`	Dimer_Tnp_hAT	343	412	1.1e-19	70.7
TkA02G337000	`PF14372`	hAT-like_RNase-H	434	449	1.4e-22	80.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M2N5`	Arabidopsis thaliana	sp\|Q9M2N5\|DSLE_ARATH Zinc finger BED domain-containing protein DAYSLEEPER	33.300%	Swiss-Prot	Low
`Q6AVI0`	Oryza sativa subsp. japonica	sp\|Q6AVI0\|RSLE2_ORYSJ Zinc finger BED domain-containing protein RICESLEEPER 2	34.500%	Swiss-Prot	Low
`B9FJG3`	Oryza sativa subsp. japonica	sp\|B9FJG3\|RSLE1_ORYSJ Zinc finger BED domain-containing protein RICESLEEPER 1	33.900%	Swiss-Prot	Low
`Q75HY5`	Oryza sativa subsp. japonica	sp\|Q75HY5\|RSLE3_ORYSJ Zinc finger BED domain-containing protein RICESLEEPER 3	32.500%	Swiss-Prot	Low
`Q0JMB2`	Oryza sativa subsp. japonica	sp\|Q0JMB2\|RSLE4_ORYSJ Zinc finger BED domain-containing protein RICESLEEPER 4	30.100%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card