TkA02G192680 | RubberDandelionOmics

Gene overview

TkA02G192680

Reference: TK1151 Chr: Chr02 Coordinates: 49401367-49404005 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1365 bp · TkA02G192680|TK1151|cDNA

GTTCTGCCCTCAAACACCCTGCTAGTAAACCGCTCGGCCTAGTCGAGAAACCTTTAAACCACAATCGACGGCAAAACTCGCTATTGTGTTCTTCGGTGAAATCATAACTTTCATCGGAAGAAATAAGTTAGGGCTCTGGCGGCACTCAAAGATTCAACGACTGCTAATCAAATGGCATCGTCGAGTAGCGGACTAACCTTTAAGCTTCACCCACTGGTGATCGTCAACATATCCGATCACCACACACGAGTCAAGTCCCA...

CDS

Download CDS FASTA

948 bp · TkA02G192680|TK1151|CDS

ATGGCATCGTCGAGTAGCGGACTAACCTTTAAGCTTCACCCACTGGTGATCGTCAACATATCCGATCACCACACACGAGTCAAGTCCCAATCTCAACCACCCACTGTCAATGGTGGTGATGCCACCTCCGCGTCTTCCAGTTCTCCGGCTCTTTCTTCACCCAGGGTGTTTGGTTGTGTCATTGGAGTTCAACGGGGACGAACTGTCGAGATCTTCAACAGCTTTGAACTTCTCTATGATCCATCCAACCATTCCCTCGA...

Protein

Download Protein FASTA

315 aa · TkA02G192680|TK1151|PROTEIN

MASSSSGLTFKLHPLVIVNISDHHTRVKSQSQPPTVNGGDATSASSSSPALSSPRVFGCVIGVQRGRTVEIFNSFELLYDPSNHSLDRSFLEKKQELYKKVFPNFYILGWYSTGADAEESDMHIHKALMDINESPVYVLLNPLINHAQKDLPVNIYESELHVIDGIPQLIFVRSSYTIETVEAERISVDHVAHLKPSDGGSAATQLAAHLTGIHSAIKMLNSRIRVLHHFLIAMQKGEIPYENSLLRQVSSLLRRLPAIE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G192680`
TK1151 ID	TkA02G192680
OH-1004 ID	LXL04_016103
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G192680

Location Chr02:49401367-49404005 (+)

Description Similar to CSN6A: COP9 signalosome complex subunit 6a

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g56280`	Component of the COP9 signalosome complex (CSN), a complex involved in various cellular and developmental processes such as photomorphogenesis and auxin and jasmonate responses.	Molecular characterization of subunit 6 of the COP9 signalosome and its role in multifaceted developmental processes in Arabidopsis.2001 · DOI: 10.1105/tpc.010248 Role of the MPN subunits in COP9 signalosome assembly and activity, and their regulatory interaction with Arabidopsis Cullin3-based E3 ligases.2007 · DOI: 10.1105/tpc.106.047571
`At4g26430`	Component of the COP9 signalosome complex (CSN), a complex involved in various cellular and developmental processes such as photomorphogenesis and auxin and jasmonate responses.	Role of the MPN subunits in COP9 signalosome assembly and activity, and their regulatory interaction with Arabidopsis Cullin3-based E3 ligases.2007 · DOI: 10.1105/tpc.106.047571

Rice

Reference gene ID	Possible function	Papers / DOI
`Os08g0500000`	Component of the COP9 signalosome complex (CSN), a complex involved in various cellular and developmental processes such as photomorphogenesis and response to hormones (Probable).	CSN6, a subunit of the COP9 signalosome, is involved in early response to iron deficiency in Oryza sativa.2016 · DOI: 10.1038/srep25485

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_016103 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000338 protein deneddylation Biological Process

GO:0006511 ubiquitin-dependent protein catabolic process Biological Process

GO:0009585 red, far-red light phototransduction Biological Process

GO:0009640 photomorphogenesis Biological Process

GO:0010387 COP9 signalosome assembly Biological Process

GO:0030163 protein catabolic process Biological Process

GO:1990641 response to iron ion starvation Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0008180 COP9 signalosome Cellular Component

GO:0045335 phagocytic vesicle Cellular Component

KEGG gene cross-reference

ath:AT4G26430

ath:AT5G56280

ddi:DDB_G0293180

dosa:Os08g0500000

osa:4345944

xla:414575

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.492

Rank 1 · TkA02G192680 · TK1151

Cytoplasm0.489

Rank 2 · TkA02G192680 · TK1151

Lysosome / Vacuole0.090

Rank 3 · TkA02G192680 · TK1151

Golgi apparatus0.065

Rank 4 · TkA02G192680 · TK1151

Cell membrane0.051

Rank 5 · TkA02G192680 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01398JAB6-133 aa

PF13012MitMem_reg182-296 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G192680	`PF01398`	JAB	6	133	1.9e-21	76.7
TkA02G192680	`PF13012`	MitMem_reg	182	296	2.1e-30	105.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8W206`	Arabidopsis thaliana	sp\|Q8W206\|CSN6A_ARATH COP9 signalosome complex subunit 6a	80.900%	Swiss-Prot	High
`Q8W1P0`	Arabidopsis thaliana	sp\|Q8W1P0\|CSN6B_ARATH COP9 signalosome complex subunit 6b	78.600%	Swiss-Prot	High
`Q6ZKM2`	Oryza sativa subsp. japonica	sp\|Q6ZKM2\|CSN6_ORYSJ COP9 signalosome complex subunit 6	77.800%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card