TkA02G109510 | RubberDandelionOmics

Gene overview

TkA02G109510

Reference: TK1151 Chr: Chr02 Coordinates: 28622027-28623142 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

924 bp · TkA02G109510|TK1151|cDNA

ATGGAGAGCATCAAGCATAGAACAGTGGCAGGTAACGGGATAAACATGCATGTAGCCGAAAAGGGCAACGGCCCGACCGTCCTTTTTCTCCATGGCTTCCCGGAGCTCTGGTACACCTGGCGTCACCAAATCCTCGCCCTAGCCGATCTCGGTTACCACGCCGTCGCACCTGACCTACGCGGCTATGGAGACACCGACGCACCACCTTCCGCAACCAGTTACACATGCCTCCATATAGTCGGGGACCTGGTGGCATTGAT...

CDS

Download CDS FASTA

924 bp · TkA02G109510|TK1151|CDS

ATGGAGAGCATCAAGCATAGAACAGTGGCAGGTAACGGGATAAACATGCATGTAGCCGAAAAGGGCAACGGCCCGACCGTCCTTTTTCTCCATGGCTTCCCGGAGCTCTGGTACACCTGGCGTCACCAAATCCTCGCCCTAGCCGATCTCGGTTACCACGCCGTCGCACCTGACCTACGCGGCTATGGAGACACCGACGCACCACCTTCCGCAACCAGTTACACATGCCTCCATATAGTCGGGGACCTGGTGGCATTGAT...

Protein

Download Protein FASTA

307 aa · TkA02G109510|TK1151|PROTEIN

MESIKHRTVAGNGINMHVAEKGNGPTVLFLHGFPELWYTWRHQILALADLGYHAVAPDLRGYGDTDAPPSATSYTCLHIVGDLVALIDSMGGDPVYLVGHDWGAMIGWYLCTFWPDKVKEYVCLSVSYCTQQPKMKPVQALRTFFGDKYYICRFQEPGEMEAEIKSYGTGHVLKTILTETRPGPLRLPKSEPFGSKTLYAPPPLPPWLSKKTGFTGGLNYYRALDLNWELTAAWTGVQVKVPAIYVVGDKDLVYTTPRAK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G109510`
TK1151 ID	TkA02G109510
OH-1004 ID	LXL04_038891
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	71.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA02G109510`
Location	Chr02:28622027-28623142 (-)
Description	Similar to ephA: Epoxide hydrolase A (Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_038891` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0009636 response to toxic substance Biological Process GO:0004301 epoxide hydrolase activity Molecular Function GO:0016787 hydrolase activity Molecular Function GO:0042803 protein homodimerization activity Molecular Function
KEGG gene cross-reference	mtu:Rv3617 mtv:RVBD_3617 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.675

Rank 1 · TkA02G109510 · TK1151

Nucleus0.240

Rank 2 · TkA02G109510 · TK1151

Peroxisome0.169

Rank 3 · TkA02G109510 · TK1151

Mitochondrion0.079

Rank 4 · TkA02G109510 · TK1151

Endoplasmic reticulum0.055

Rank 5 · TkA02G109510 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07224Chlorophyllase19-61 aa

PF00561Abhydrolase_125-148 aa

PF12146Hydrolase_426-141 aa

PF12697Abhydrolase_627-296 aa

PF20927Htt_C-HEAT125-157 aa

PF12146Hydrolase_4238-255 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G109510	`PF07224`	Chlorophyllase	19	61	0.049	13.1
TkA02G109510	`PF00561`	Abhydrolase_1	25	148	1.7e-25	90.9
TkA02G109510	`PF12146`	Hydrolase_4	26	141	2e-10	41.1
TkA02G109510	`PF12697`	Abhydrolase_6	27	296	9e-23	82.8
TkA02G109510	`PF20927`	Htt_C-HEAT	125	157	0.39	9.1
TkA02G109510	`PF12146`	Hydrolase_4	238	255	2e-10	41.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card