TkA02G090650 | RubberDandelionOmics

Gene overview

TkA02G090650

Reference: TK1151 Chr: Chr02 Coordinates: 23552994-23559248 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2388 bp · TkA02G090650|TK1151|cDNA

ATTTCAAATACTCAAATAGTGTATTCTGTAAACTCCCTGAAGATAATACGGGACGGAAGTAGTAGCATATAACAGGTGTCACCAAAAGGGGCTAATTTTAGCACCCGTAACTCCACTTTCCTCGTTTCTTGACATCCTCCGAGAAAAACCCTAGAATCGGCAGATAACAATGAAACGGAAACGTGCACCTAAGAAGGAAATACCTAAAATGCCCTTGGCAAAGAAAAGACTCCAACTCCAAAAGACTGATGCTTTAATGG...

CDS

Download CDS FASTA

1968 bp · TkA02G090650|TK1151|CDS

ATGAAACGGAAACGTGCACCTAAGAAGGAAATACCTAAAATGCCCTTGGCAAAGAAAAGACTCCAACTCCAAAAGACTGATGCTTTAATGGCAGAAAATCATGTGATTAATGATGAAATACAAGAACCTGAAAATATCACCTCAGTGCACATGGAAATTGAAGATTCAAGAACTAAACAAGTATTAAGTGAAATTATTAAAAGAGTTATAAAAGAGATTTCAAAGGAATCTGGAGGCTTAAATAGCCTTACAAAGAGCTT...

Protein

Download Protein FASTA

655 aa · TkA02G090650|TK1151|PROTEIN

MKRKRAPKKEIPKMPLAKKRLQLQKTDALMAENHVINDEIQEPENITSVHMEIEDSRTKQVLSEIIKRVIKEISKESGGLNSLTKSLIDSSINNGDTKQPNADVDIEENERKHHQNQEYKQEELNAALIVIKKTMKLDASDPFNRPVDPVELGIPDYFDVIKTPMDFGTICNNIENGLKYMNSADVFKDVEYIWCNCVKYNKKGDVILDLMKRVKTYFMRNWKAAGLQTEQSVSVSPRIVDTILRKKDHSLSPPANNLTQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G090650`
TK1151 ID	TkA02G090650
OH-1004 ID	LXL04_016950
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	94.300
Protein coverage (%)	TK1151 98.779 / OH-1004 97.713 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA02G090650`
Location	Chr02:23552994-23559248 (-)
Description	Similar to BDF2: Bromodomain-containing factor 2 (Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_016950` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006281 DNA repair Biological Process GO:0006338 chromatin remodeling Biological Process GO:0006351 DNA-templated transcription Biological Process GO:0006355 regulation of DNA-templated transcription Biological Process GO:0006357 regulation of transcription by RNA polymerase II Biological Process GO:0006974 DNA damage response Biological Process GO:0010971 positive regulation of G2/M transition of mitotic cell cycle Biological Process GO:0030435 sporulation resulting in formation of a cellular spore Biological Process GO:0031452 negative regulation of heterochromatin formation Biological Process GO:0032968 positive regulation of transcription elongation by RNA polymerase II Biological Process GO:0043922 host-mediated suppression of viral transcription Biological Process GO:0045893 positive regulation of DNA-templated transcription Biological Process
KEGG gene cross-reference	hsa:23476 sce:YDL070W These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.957

Rank 1 · TkA02G090650 · TK1151

Cytoplasm0.118

Rank 2 · TkA02G090650 · TK1151

Cell membrane0.018

Rank 3 · TkA02G090650 · TK1151

Mitochondrion0.017

Rank 4 · TkA02G090650 · TK1151

Endoplasmic reticulum0.008

Rank 5 · TkA02G090650 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03004Transposase_2458-89 aa

PF04136COG3_N66-87 aa

PF00439Bromodomain130-211 aa

PF04136COG3_N165-191 aa

PF03004Transposase_24189-206 aa

PF03004Transposase_24284-309 aa

PF03004Transposase_24443-574 aa

PF03004Transposase_24599-655 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G090650	`PF03004`	Transposase_24	58	89	1.6e-28	100.3
TkA02G090650	`PF04136`	COG3_N	66	87	0.29	11.8
TkA02G090650	`PF00439`	Bromodomain	130	211	1.6e-17	63.9
TkA02G090650	`PF04136`	COG3_N	165	191	0.29	11.8
TkA02G090650	`PF03004`	Transposase_24	189	206	1.6e-28	100.3
TkA02G090650	`PF03004`	Transposase_24	284	309	1.6e-28	100.3
TkA02G090650	`PF03004`	Transposase_24	443	574	1.6e-28	100.3
TkA02G090650	`PF03004`	Transposase_24	599	655	1.6e-28	100.3
TkA02G090650	`PF00439`	Bromodomain	599	633	1.6e-17	63.9
TkA02G090650	`PF04136`	COG3_N	609	648	0.29	11.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card