RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA02G028500
Reference: TK1151 Chr: Chr02 Coordinates: 6903979-6908405 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

929 bp · TkA02G028500|TK1151|cDNA

CTTCTTTCTTGTTCAAAAGGAAATTTTTAATTCCATATATTCTTGCTTCCACTTGTCTGTCAATGTGGAGAATGATGGTGAAGTCTATTTGGTCAAAGAAAAAAAGAAGAGCAAATGGATAGATGTTATTGATAAAAGGATCTATGAGGATGATGATGATGATCCGTTTGCTGTTTATAGAGAGCCTCTTGTTGATCTTTGTCCTGATACTGATTTCAAGGTATGTTTAACTATCTATTTTTTATACATGTTCACAGTGT...

CDS

Download CDS FASTA

531 bp · TkA02G028500|TK1151|CDS

ATGAATTTCATTCAGGAAGGATTCTTGTGTCGCCATATTTTTTATGTCTTCAATATCAAGGATATTGATATAATTCCATCGAAATATATTTTGAGGCGTTGGCGCAAGGACAACATTGCTACTGAAGTGTTGGTACAGAAATTTTCAAATACCGGAGAAGAAGGGAAATTGGTTAAAGATGCTTTTGCTATCTTTATTTCAATTGTCAATAAATTGGGGCGCGAGGAGAATGGGTTGAAGAACTTTATATCCAATCTTGA...

Protein

Download Protein FASTA

176 aa · TkA02G028500|TK1151|PROTEIN

MNFIQEGFLCRHIFYVFNIKDIDIIPSKYILRRWRKDNIATEVLVQKFSNTGEEGKLVKDAFAIFISIVNKLGREENGLKNFISNLEDMHELLNERGKSKESYNKESRMASLRGASVPEHIEIQNPEGIRNKGTGKRLISNRDKSIAASKKRKRDCALCHNPYHDARTCHLRNKDK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA02G028500
TK1151 IDTkA02G028500
OH-1004 IDLXL04_022772
Relationship / confidenceMulti Candidate From Tk1151 / Complex relationship
Protein identity (%)93.800
Protein coverage (%)TK1151 100.000 / OH-1004 26.748
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA02G028500
LocationChr02:6903979-6908405 (-)
DescriptionSimilar to FRS5: Protein FAR1-RELATED SEQUENCE 5
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_022772 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006355 regulation of DNA-templated transcription Biological Process
GO:0009639 response to red or far red light Biological Process
GO:0010017 red or far-red light signaling pathway Biological Process
GO:0010018 far-red light signaling pathway Biological Process
GO:0010218 response to far red light Biological Process
GO:0042753 positive regulation of circadian rhythm Biological Process
GO:0045893 positive regulation of DNA-templated transcription Biological Process
GO:1900056 negative regulation of leaf senescence Biological Process
GO:0005634 nucleus Cellular Component
GO:0009506 plasmodesma Cellular Component
GO:0003700 DNA-binding transcription factor activity Molecular Function
GO:0008270 zinc ion binding Molecular Function
KEGG gene cross-reference
ath:AT2G27110
ath:AT4G15090
ath:AT4G38180
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.939
Rank 1 · TkA02G028500 · TK1151
Cytoplasm0.135
Rank 2 · TkA02G028500 · TK1151
Mitochondrion0.018
Rank 3 · TkA02G028500 · TK1151
Extracellular0.012
Rank 4 · TkA02G028500 · TK1151
Cell membrane0.011
Rank 5 · TkA02G028500 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser