TkA01G641230 | RubberDandelionOmics

Gene overview

TkA01G641230

Reference: TK1151 Chr: Chr01 Coordinates: 162270357-162271638 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1067 bp · TkA01G641230|TK1151|cDNA

GCCATCACTTCACATTTACCAAGAAGAACCGACAACGGGATTAAGAATTTCTGGAATTCTCATCTACGAAAGCGGAATCCCGGCCTTCAAACCAATCTACCTTCCAATTCAACAGATAATAAAGTAGAAGCTAAAGCTGAAGCGAAGCTATCCATGGATCCGATGAGTGTCAGCAATAACTTCCTCCATGAATGTTGTTCTAGCGATGGAGAAGCTTTTCAGAAACATATGGCGTATGGTATCCAAAACCCTATAAAGAT...

CDS

Download CDS FASTA

441 bp · TkA01G641230|TK1151|CDS

GCCATCACTTCACATTTACCAAGAAGAACCGACAACGGGATTAAGAATTTCTGGAATTCTCATCTACGAAAGCGGAATCCCGGCCTTCAAACCAATCTACCTTCCAATTCAACAGATAATAAAGTAGAAGCTAAAGCTGAAGCGAAGCTATCCATGGATCCGATGAGTGTCAGCAATAACTTCCTCCATGAATGTTGTTCTAGCGATGGAGAAGCTTTTCAGAAACATATGGCGTATGGTATCCAAAACCCTATAAAGAT...

Protein

Download Protein FASTA

146 aa · TkA01G641230|TK1151|PROTEIN

AITSHLPRRTDNGIKNFWNSHLRKRNPGLQTNLPSNSTDNKVEAKAEAKLSMDPMSVSNNFLHECCSSDGEAFQKHMAYGIQNPIKIESDYFVTVQEGPNSTSESCDQSVKEEMMNGSESQNSYDSDITVDLLIDFPNDGEYLQYV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G641230`
TK1151 ID	TkA01G641230
OH-1004 ID	LXL04_021663
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	42.400
Protein coverage (%)	TK1151 100.000 / OH-1004 57.430 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G641230

Location Chr01:162270357-162271638 (+)

Description Similar to MYB17: Transcription factor MYB17

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g61420`	Major regulator of short-chained aliphatic glucosinolates (GLSs) biosynthesis.	Omics-based identification of Arabidopsis Myb transcription factors regulating aliphatic glucosinolate biosynthesis.2007 · DOI: 10.1073/pnas.0611629104 The R2R3-MYB transcription factor HAG1/MYB28 is a regulator of methionine-derived glucosinolate biosynthesis in Arabidopsis thaliana.2007 · DOI: 10.1111/j.1365-313x.2007.03133.x HAG2/MYB76 and HAG3/MYB29 exert a specific and coordinated control on the regulation of aliphatic glucosinolate biosynthesis in Arabidopsis thaliana.2008 · DOI: 10.1111/j.1469-8137.2007.02295.x The impact of the absence of aliphatic glucosinolates on insect herbivory in Arabidopsis.2008 · DOI: 10.1371/journal.pone.0002068 A complex interplay of three R2R3 MYB transcription factors determines the profile of aliphatic glucosinolates in Arabidopsis.2010 · DOI: 10.1104/pp.109.149286 BZR1 and BES1 participate in regulation of glucosinolate biosynthesis by brassinosteroids in Arabidopsis.2013 · DOI: 10.1093/jxb/ert094 Novel insights into the function of Arabidopsis R2R3-MYB transcription factors regulating aliphatic glucosinolate biosynthesis.2013 · DOI: 10.1093/pcp/pct085
`At5g15310`	Involved in the control of epidermal cell morphogenesis in petals.	Control of cell and petal morphogenesis by R2R3 MYB transcription factors.2007 · DOI: 10.1242/dev.02836 MIXTA-like transcription factors and WAX INDUCER1/SHINE1 coordinately regulate cuticle development in Arabidopsis and Torenia fournieri.2013 · DOI: 10.1105/tpc.113.110783 The MIXTA-like transcription factor MYB16 is a major regulator of cuticle formation in vegetative organs.2013 · DOI: 10.4161/psb.26826

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021663 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000902 cell morphogenesis Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009825 multidimensional cell growth Biological Process

GO:0009908 flower development Biological Process

GO:0009909 regulation of flower development Biological Process

GO:0010091 trichome branching Biological Process

GO:0010143 cutin biosynthetic process Biological Process

GO:0045892 negative regulation of DNA-templated transcription Biological Process

GO:0080090 regulation of primary metabolic process Biological Process

GO:0080091 regulation of raffinose metabolic process Biological Process

GO:1901957 regulation of cutin biosynthetic process Biological Process

KEGG gene cross-reference

ath:AT3G01140

ath:AT3G61250

ath:AT4G05100

ath:AT4G28110

ath:AT5G15310

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.939

Rank 1 · TkA01G641230 · TK1151

Cytoplasm0.210

Rank 2 · TkA01G641230 · TK1151

Mitochondrion0.026

Rank 3 · TkA01G641230 · TK1151

Cell membrane0.019

Rank 4 · TkA01G641230 · TK1151

Golgi apparatus0.009

Rank 5 · TkA01G641230 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00249Myb_DNA-binding2-22 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G641230	`PF00249`	Myb_DNA-binding	2	22	0.0019	19.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SPG2`	Arabidopsis thaliana	sp\|Q9SPG2\|MYB28_ARATH Transcription factor MYB28	35.700%	Swiss-Prot	Medium
`Q9LXF1`	Arabidopsis thaliana	sp\|Q9LXF1\|MYB16_ARATH Transcription factor MYB16	54.800%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card