TkA01G625020 | RubberDandelionOmics

Gene overview

TkA01G625020

Reference: TK1151 Chr: Chr01 Coordinates: 157772897-157773851 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

669 bp · TkA01G625020|TK1151|cDNA

ATGGAAGACGATTTCAATGAGCAAAATGAGGAATTTTCACCCACTACAAATGTCCAAAGTGAGGAAACTTCAAGTGCTAGTAGTAAGAAAAGGAAGCGTATAGATCCTTTCATCGAGGGAATATCTAATGCCGCCGCGTTACTTGGCAAAGAACTCCGGGTCGCATCGACTACTTTGTCTCAATCTTTAAATGCGGAAGTGGAGTTACAAAAGAAAACTTCTATGGTGACAGCTGAAATTTTGAAGATTACATCAATGAA...

CDS

Download CDS FASTA

669 bp · TkA01G625020|TK1151|CDS

ATGGAAGACGATTTCAATGAGCAAAATGAGGAATTTTCACCCACTACAAATGTCCAAAGTGAGGAAACTTCAAGTGCTAGTAGTAAGAAAAGGAAGCGTATAGATCCTTTCATCGAGGGAATATCTAATGCCGCCGCGTTACTTGGCAAAGAACTCCGGGTCGCATCGACTACTTTGTCTCAATCTTTAAATGCGGAAGTGGAGTTACAAAAGAAAACTTCTATGGTGACAGCTGAAATTTTGAAGATTACATCAATGAA...

Protein

Download Protein FASTA

222 aa · TkA01G625020|TK1151|PROTEIN

MEDDFNEQNEEFSPTTNVQSEETSSASSKKRKRIDPFIEGISNAAALLGKELRVASTTLSQSLNAEVELQKKTSMVTAEILKITSMNQSDKFKESRKIMREPEAVLTFWNLEGEDRETFVKLMIELQHKFWQPNVQQDSITAQFNYHSIQLQQNSITAYSIPQHYNQPNRPLGIELLSINQPNTPYNCTITSDYTQLQPNKHPLTLLCSSAFCHLLHLLILV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G625020`
TK1151 ID	TkA01G625020
OH-1004 ID	LXL04_010725
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	96.800
Protein coverage (%)	TK1151 56.306 / OH-1004 19.531 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA01G625020`
Location	Chr01:157772897-157773851 (+)
Description	Similar to FACE1: CAAX prenyl protease 1 homolog
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_010725` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006281 DNA repair Biological Process GO:0006325 chromatin organization Biological Process GO:0006355 regulation of DNA-templated transcription Biological Process GO:0006508 proteolysis Biological Process GO:0006629 lipid metabolic process Biological Process GO:0006974 DNA damage response Biological Process GO:0006997 nucleus organization Biological Process GO:0006998 nuclear envelope organization Biological Process GO:0007346 regulation of mitotic cell cycle Biological Process GO:0008016 regulation of heart contraction Biological Process GO:0008340 determination of adult lifespan Biological Process GO:0008360 regulation of cell shape Biological Process
KEGG gene cross-reference	ath:AT4G01320 dosa:Os02g0680400 hsa:10269 mmu:230709 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.894

Rank 1 · TkA01G625020 · TK1151

Cytoplasm0.244

Rank 2 · TkA01G625020 · TK1151

Mitochondrion0.024

Rank 3 · TkA01G625020 · TK1151

Cell membrane0.018

Rank 4 · TkA01G625020 · TK1151

Endoplasmic reticulum0.013

Rank 5 · TkA01G625020 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF24911YfjL_C55-163 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G625020	`PF24911`	YfjL_C	55	163	0.0065	17.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card