TkA01G623740 | RubberDandelionOmics

Gene overview

TkA01G623740

Reference: TK1151 Chr: Chr01 Coordinates: 157430091-157433188 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1722 bp · TkA01G623740|TK1151|cDNA

TTTCAACTGAATAGTCATCCACCGTTACACTTCCTGGTATATCTCCAAATCCCCAAATTACAGCAGAGATCCATTCAAATCGGAAGAAATAAACCACCACCATCTCAATAAATGTCTTCACTTCCTAAACCCTTTCACTCCAATCGAAGCGAATGGAAAGCAGAAGACGGTGAATACAACAAGAAGATCGGAGCTGTGTTGGTTAAGAATGAATACAACAAGAAGATGTTCTTCAAGACCATTGTTCTTAGCAACAATGT...

CDS

Download CDS FASTA

555 bp · TkA01G623740|TK1151|CDS

ATGTCTTCACTTCCTAAACCCTTTCACTCCAATCGAAGCGAATGGAAAGCAGAAGACGGTGAATACAACAAGAAGATCGGAGCTGTGTTGGTTAAGAATGAATACAACAAGAAGATGTTCTTCAAGACCATTGTTCTTAGCAACAATGTCACTTTCACCTGCGAGTCTTGGGTTGCTTCCAAGTTTGATAACCCCGACAAGCGAATCTTCTTCACCGATAAGTCTTATCTGCCGTCGAAAACGCCGGAAGCCCCTGAAAC...

Protein

Download Protein FASTA

184 aa · TkA01G623740|TK1151|PROTEIN

MSSLPKPFHSNRSEWKAEDGEYNKKIGAVLVKNEYNKKMFFKTIVLSNNVTFTCESWVASKFDNPDKRIFFTDKSYLPSKTPEAPETIDTKHESVIQLVTEWPLKSKLDPEVYGPPESPITKEIVEQEIKGFMTLEENLTLSGAFLRLSNANISIQSISCKVPVLQQQLLFDLNQECRFMGGGF

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G623740`
TK1151 ID	TkA01G623740
OH-1004 ID	LXL04_000266
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	95.100
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G623740

Location Chr01:157430091-157433188 (+)

Description Similar to LOX2: Lipoxygenase 2, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g45140`	13S-lipoxygenase that can use linolenic acid as substrates.	A chloroplast lipoxygenase is required for wound-induced jasmonic acid accumulation in Arabidopsis.1995 · DOI: 10.1073/pnas.92.19.8675

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0179900`	Plant lipoxygenase may be involved in a number of diverse aspects of plant physiology including growth and development, pest resistance, and senescence or responses to wounding.	No verified direct reference in this release
`Os08g0509100`	Plant lipoxygenase may be involved in a number of diverse aspects of plant physiology including growth and development, pest resistance, and senescence or responses to wounding.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000266 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006633 fatty acid biosynthetic process Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009611 response to wounding Biological Process

GO:0009617 response to bacterium Biological Process

GO:0009620 response to fungus Biological Process

GO:0009695 jasmonic acid biosynthetic process Biological Process

GO:0009753 response to jasmonic acid Biological Process

GO:0010597 green leaf volatile biosynthetic process Biological Process

GO:0031408 oxylipin biosynthetic process Biological Process

GO:0034440 lipid oxidation Biological Process

GO:0051707 response to other organism Biological Process

GO:0080027 response to herbivore Biological Process

KEGG gene cross-reference

ath:AT3G45140

sot:102596122

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.482

Rank 1 · TkA01G623740 · TK1151

Nucleus0.273

Rank 2 · TkA01G623740 · TK1151

Mitochondrion0.170

Rank 3 · TkA01G623740 · TK1151

Cell membrane0.110

Rank 4 · TkA01G623740 · TK1151

Endoplasmic reticulum0.106

Rank 5 · TkA01G623740 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01477PLAT25-71 aa

PF00305Lipoxygenase34-140 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G623740	`PF01477`	PLAT	25	71	5.9e-05	24.5
TkA01G623740	`PF00305`	Lipoxygenase	34	140	1.3e-12	47.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P38418`	Arabidopsis thaliana	sp\|P38418\|LOX2_ARATH Lipoxygenase 2, chloroplastic	54.100%	Swiss-Prot	Low
`Q8H016`	Oryza sativa subsp. japonica	sp\|Q8H016\|LOX6_ORYSJ Probable lipoxygenase 6	43.500%	Swiss-Prot	Low
`Q84YK8`	Oryza sativa subsp. japonica	sp\|Q84YK8\|LOXC2_ORYSJ Probable lipoxygenase 8, chloroplastic	38.900%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card