TkA01G617850 | RubberDandelionOmics

Gene overview

TkA01G617850

Reference: TK1151 Chr: Chr01 Coordinates: 155928142-155930589 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

944 bp · TkA01G617850|TK1151|cDNA

AAAACCAGCTAGCCAATTTTCTTTTACCGGCTTTAAACGAAATATGAACATCCATTTGCCCATTCATCGTCGTGTTAATTTACAAATCTACCACGCAAATTCTACTTTCTTCAACCTCACGACCAGCGGCCTTCTTCTTGCCGGCGAGGCAGCAGGTCACGGAGAATCACTATCCCCTGGTTACCAATGTCAAGGCTTACTAAATTGTTGCAAAAGGGGAAGAGGGCTTTGCAAGAACTGGAACTGGTTAAAGTCTTGCA...

CDS

Download CDS FASTA

600 bp · TkA01G617850|TK1151|CDS

ATGTCAAGGCTTACTAAATTGTTGCAAAAGGGGAAGAGGGCTTTGCAAGAACTGGAACTGGTTAAAGTCTTGCAATCAGAGATAAGATATGAGCTTGCTAATGATCCCTATAAGAATGAAACTGGATCTTCAGGAGATTTTGTGATGGACTGGGATTCCCAAGATTCCAAAGATGTAATTTTGCGTAAAAAGTGTGAATCTGGTGAGGAGCTTGCTATTTCTGCATTATTAGGTGATGAGACCTTTCTAGGAGACGAATG...

Protein

Download Protein FASTA

199 aa · TkA01G617850|TK1151|PROTEIN

MSRLTKLLQKGKRALQELELVKVLQSEIRYELANDPYKNETGSSGDFVMDWDSQDSKDVILRKKCESGEELAISALLGDETFLGDECYPKEVDMKVCIKKTGLPSILQFDCKVLDQGQNKIDFHIQNAYYLKSPIDLSSSVYKGPLFRNLDPSLQQELKEYLISRGIEKTLANFLLVHLHKKEQNQYIKWLQKLEAMVA

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G617850`
TK1151 ID	TkA01G617850
OH-1004 ID	LXL04_000350
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	96.600
Protein coverage (%)	TK1151 100.000 / OH-1004 89.823 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA01G617850`
Location	Chr01:155928142-155930589 (-)
Description	Similar to MAM33: Mitochondrial acidic protein MAM33 (Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_000350` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0009060 aerobic respiration Biological Process GO:0042256 cytosolic ribosome assembly Biological Process GO:1902775 mitochondrial large ribosomal subunit assembly Biological Process GO:0005737 cytoplasm Cellular Component GO:0005739 mitochondrion Cellular Component GO:0005759 mitochondrial matrix Cellular Component GO:0097177 mitochondrial ribosome binding Molecular Function
KEGG gene cross-reference	sce:YIL070C spo:2541189 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.877

Rank 1 · TkA01G617850 · TK1151

Cytoplasm0.100

Rank 2 · TkA01G617850 · TK1151

Nucleus0.099

Rank 3 · TkA01G617850 · TK1151

Plastid0.029

Rank 4 · TkA01G617850 · TK1151

Cell membrane0.016

Rank 5 · TkA01G617850 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23584DUF713614-58 aa

PF02330MAM3390-196 aa

PF28740CG7065_bundle147-162 aa

PF00178Ets169-193 aa

PF28740CG7065_bundle170-196 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G617850	`PF23584`	DUF7136	14	58	0.26	11.8
TkA01G617850	`PF02330`	MAM33	90	196	1.4e-21	78.2
TkA01G617850	`PF28740`	CG7065_bundle	147	162	0.55	10.4
TkA01G617850	`PF00178`	Ets	169	193	0.15	13.1
TkA01G617850	`PF28740`	CG7065_bundle	170	196	0.55	10.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card