TkA01G605170 | RubberDandelionOmics

Gene overview

TkA01G605170

Reference: TK1151 Chr: Chr01 Coordinates: 152508503-152510194 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1254 bp · TkA01G605170|TK1151|cDNA

CCTACTATAAATACCAAACACTGGTGTCAAGCACTTGCAACTCACCACCATACAAAAAAACAAAAAGTGTCAAATTGTAGAGAGAGAGAAAGCTAAAAGAAGCTAAAAATGGTTCATATAGAAGATGATGAAACCCTAAGAAAAGGTCCATGGACCGAACACGAAGATGTTCAGTTGGCTTTTAACGTGAACATGTTTGGGGATCGCCGCTGGGATTTCATAGCAAAAGTTTCAGGTTTGAAGGTGGCGGGAGATACAAA...

CDS

Download CDS FASTA

573 bp · TkA01G605170|TK1151|CDS

ATGACCCCTCATGAAGAGAAGCTAGTTCTTGAATACCATTCTAAATGGGGAAACAGATGGTCGAGAATTGCTAGAAAATTGCCGGGTCGTACAGATAACGAGATCAAGAACTATTGGAGAACTCATATGAGAAAAAAAGCTCAAGAAAACAAAAGGGCGTCATCTCCATCTTCATCTTTCTCCAACAGCTCTTCTTCCTCATCAATTACTCACGATCCCACCGTTGATTCCATGCTCTTGACTGAGACCAAAGATCGAAT...

Protein

Download Protein FASTA

190 aa · TkA01G605170|TK1151|PROTEIN

MTPHEEKLVLEYHSKWGNRWSRIARKLPGRTDNEIKNYWRTHMRKKAQENKRASSPSSSFSNSSSSSSITHDPTVDSMLLTETKDRISFYDTGGIEMVPATHRGKNNYKDSSEEQEKVYSMDEIWEDIDSLENNGFKPVFDLYSNVTPSSHQIWDYSYPVNNFWMMDGGDQQDLISTDMFFPATSEVLLG

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G605170`
TK1151 ID	TkA01G605170
OH-1004 ID	LXL04_000518
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.500
Protein coverage (%)	TK1151 100.000 / OH-1004 73.930 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G605170

Location Chr01:152508503-152510194 (+)

Description Similar to MYB48: Transcription factor MYB48

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g46130`	Transcription factor.	No verified direct reference in this release
`At5g59780`	Transcription factor.	No verified direct reference in this release
`At1g68320`	Transcription repressor of phosphate (Pi) starvation-induced genes.	Phosphate starvation responses and gibberellic acid biosynthesis are regulated by the MYB62 transcription factor in Arabidopsis.2009 · DOI: 10.1093/mp/ssn081

Rice

Reference gene ID	Possible function	Papers / DOI
`Os12g0567300`	Transcription factor.	No verified direct reference in this release
`Os11g0700500`	Transcription factor.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000518 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009646 response to absence of light Biological Process

GO:0035865 cellular response to potassium ion Biological Process

GO:0043266 regulation of potassium ion transport Biological Process

GO:0005634 nucleus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0003677 DNA binding Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

GO:0043565 sequence-specific DNA binding Molecular Function

KEGG gene cross-reference

ath:AT3G46130

ath:AT3G53200

ath:AT5G59780

dosa:Os11g0700500

dosa:Os12g0567300

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.942

Rank 1 · TkA01G605170 · TK1151

Cytoplasm0.174

Rank 2 · TkA01G605170 · TK1151

Cell membrane0.025

Rank 3 · TkA01G605170 · TK1151

Endoplasmic reticulum0.015

Rank 4 · TkA01G605170 · TK1151

Mitochondrion0.013

Rank 5 · TkA01G605170 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00249Myb_DNA-binding2-42 aa

PF13921Myb_DNA-bind_62-49 aa

PF14303NAM-associated10-134 aa

PF15963Myb_DNA-bind_713-62 aa

PF10500SR-2531-71 aa

PF12033DUF351931-76 aa

PF07125DUF137834-53 aa

PF27961CSNKA2IP41-82 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G605170	`PF00249`	Myb_DNA-binding	2	42	1.7e-16	60.8
TkA01G605170	`PF13921`	Myb_DNA-bind_6	2	49	8.4e-07	29.8
TkA01G605170	`PF14303`	NAM-associated	10	134	0.11	14.1
TkA01G605170	`PF15963`	Myb_DNA-bind_7	13	62	0.084	13.4
TkA01G605170	`PF10500`	SR-25	31	71	0.0081	16.5
TkA01G605170	`PF12033`	DUF3519	31	76	1.4	10.0
TkA01G605170	`PF07125`	DUF1378	34	53	0.25	12.2
TkA01G605170	`PF27961`	CSNKA2IP	41	82	0.2	11.8
TkA01G605170	`PF12033`	DUF3519	106	119	1.4	10.0
TkA01G605170	`PF12033`	DUF3519	158	165	1.4	10.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LX82`	Arabidopsis thaliana	sp\|Q9LX82\|MYB48_ARATH Transcription factor MYB48	50.000%	Swiss-Prot	High
`Q4JL84`	Arabidopsis thaliana	sp\|Q4JL84\|MYB59_ARATH Transcription factor MYB59	48.600%	Swiss-Prot	Medium
`Q9C9G7`	Arabidopsis thaliana	sp\|Q9C9G7\|MYB62_ARATH Transcription factor MYB62	69.400%	Swiss-Prot	Low
`Q4JL76`	Oryza sativa subsp. japonica	sp\|Q4JL76\|MYBA2_ORYSJ Myb-related protein MYBAS2	39.900%	Swiss-Prot	Medium
`Q53NK6`	Oryza sativa subsp. japonica	sp\|Q53NK6\|MYBA1_ORYSJ Myb-related protein MYBAS1	81.600%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card