Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1759 bp · TkA01G590420|TK1151|cDNA
CTAATAAGTAATAACTACTTTACTTAACGTAATTGTTTTCACGAAATAGTGATGATGGCAATTCATACGTTAAAATCAATAGAATGGAATCAACATCTTCATAGTTTTTACTCTTGGTTACTTATTTGACAAACGTGTAAATTGGTGTATTCATAGATATTGTGTATTTAGACCATGAATGTGTGCATTCAGTAACACCGTTTGCTAGCCTCTTAAATTTTGCCTCTTAATTTTTAAAATACCTCTGAAATTTTAAGAGG...
714 bp · TkA01G590420|TK1151|CDS
ATGCTGAATTACACACGAACCATTCTTAGAAGAACTTCATTGTCCAATCTCATTTATTTCAATCACACGCATACAATCTCAACCTCATCATCAAGCCCTAGCTTATCAATATGGAGACGAAAGAAGGAATTGGGAAAAGAAGGTTTAATAATTACAAAAGAGCTCAAGAGACTTCAATCCAGTCCTCCCAGACTTGACCGATTCATCAAATCCCATGTCTCTCGCCTTCTCAAATCCGACCTTGTTTCTGTTCTTTTTGA...
Protein
Download Protein FASTA237 aa · TkA01G590420|TK1151|PROTEIN
MLNYTRTILRRTSLSNLIYFNHTHTISTSSSSPSLSIWRRKKELGKEGLIITKELKRLQSSPPRLDRFIKSHVSRLLKSDLVSVLFEFQRQDLVFLSMKLYEVVRKEIWYRPDMFFYRDMLMMLARNKKAEEIKRVWDDLTKEEVHFDQHTFGDIIRAFLDSGLPLEAMFVYDEMRKSPDPPLSLPYRVILKGLLPYPELREKVKDDFLQLFPGMVIYDPPEGLFEECLSSEEGESN
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA01G590420 |
|---|---|
| TK1151 ID | TkA01G590420 |
| OH-1004 ID | LXL04_000746 |
| Relationship / confidence | Rbh High Identity Coverage Synteny / Strict |
| Protein identity (%) | 97.900 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA01G590420 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr01:148571680-148574921 (-) | |||||||||
| Description | Similar to At1g62350: Pentatricopeptide repeat-containing protein At1g62350 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0000373 Group II intron splicing Biological Process GO:0006397 mRNA processing Biological Process GO:0009658 chloroplast organization Biological Process GO:0009793 embryo development ending in seed dormancy Biological Process GO:0042793 plastid transcription Biological Process GO:0045893 positive regulation of DNA-templated transcription Biological Process GO:0090617 mitochondrial mRNA 5'-end processing Biological Process GO:0005634 nucleus Cellular Component GO:0005739 mitochondrion Cellular Component GO:0009507 chloroplast Cellular Component GO:0009535 chloroplast thylakoid membrane Cellular Component GO:0042644 chloroplast nucleoid Cellular Component | |||||||||
| KEGG gene cross-reference | ath:AT1G62350 ath:AT1G62910 ath:AT1G74850 ath:AT3G27750 ath:AT3G46870 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF13812PPR_3102-158 aaPF29070MSC6_N111-163 aaPF13041PPR_2112-159 aaPF01535PPR117-143 aaPF23276TPR_24120-194 aaPF13812PPR_3135-191 aaPF01535PPR151-178 aaPF13041PPR_2155-194 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA01G590420 | PF13812 | PPR_3 | 102 | 158 | 0.15 | 12.9 |
| TkA01G590420 | PF29070 | MSC6_N | 111 | 163 | 0.11 | 12.3 |
| TkA01G590420 | PF13041 | PPR_2 | 112 | 159 | 3.8e-06 | 27.6 |
| TkA01G590420 | PF01535 | PPR | 117 | 143 | 3.1e-05 | 24.6 |
| TkA01G590420 | PF23276 | TPR_24 | 120 | 194 | 0.0095 | 16.6 |
| TkA01G590420 | PF13812 | PPR_3 | 135 | 191 | 0.15 | 12.9 |
| TkA01G590420 | PF01535 | PPR | 151 | 178 | 3.1e-05 | 24.6 |
| TkA01G590420 | PF13041 | PPR_2 | 155 | 194 | 3.8e-06 | 27.6 |
| TkA01G590420 | PF01535 | PPR | 223 | 229 | 3.1e-05 | 24.6 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.