TkA01G586780 | RubberDandelionOmics

Gene overview

TkA01G586780

Reference: TK1151 Chr: Chr01 Coordinates: 147594895-147598375 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2107 bp · TkA01G586780|TK1151|cDNA

CACCCCGTATCCCCAGCCGACCCCCTTCAACTTTCTTCTATATAACTTCATTGCAACTCATCCTATAACCTTCCCCCCTTCCCTCCGATCGATAATTTTGTGTTGCTTTTATTTGCACCACCTTCAATCATCAAGACCCAACACCACAATCCTCATTCATCACTTCGTGTCTTTACTCAATCCCATGTCAATATAATGTGATTCTTTACATTCTTTTGTGATTCGGTATTCTTTTAGAGCAATTTCTGATCTGCGTTTTC...

CDS

Download CDS FASTA

1464 bp · TkA01G586780|TK1151|CDS

ATGGATAGAGACTTCTTCCTCAATACCGGGTTACAGTTCGAACCGTCTTCTCAATCACCCTGGAAGCTGATGACGTTGATGCCGGAAATGAAATTTCCGGCGGAGCAAGCTTCTGCTCACGGTGTTTCCCGGCCAAATTGGGAGAAATCAGATCAGTACTCGCATTTCGAATCTTCTCTGAGTTCAATGGTCTCTTCCCCTGTTTCTAATTCCACAGTATCCAATGACATTGTTGCTATCCGTGAACTTATCGGAAAATT...

Protein

Download Protein FASTA

487 aa · TkA01G586780|TK1151|PROTEIN

MDRDFFLNTGLQFEPSSQSPWKLMTLMPEMKFPAEQASAHGVSRPNWEKSDQYSHFESSLSSMVSSPVSNSTVSNDIVAIRELIGKFRDSSPAAMTAPPPYSSINTPLNPSPPKLNLPIMDHFIQENLPRIQNSMPLNPNLPLLTTDPGFAERAAKFSCFGSHSFNGRSNQLGMNSNPPEIQVGSSGSPVSKTAKFPRVSSSPALKIDRSPVSFEGNRNSEDINMKLSRLPGSAANSNEESSVSEQLPSGELGFKNQKDS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G586780`
TK1151 ID	TkA01G586780
OH-1004 ID	LXL04_000798
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.400
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G586780

Location Chr01:147594895-147598375 (-)

Description Similar to BHLH62: Transcription factor bHLH62

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g07340`	Transcription factor bHLH62.	No verified direct reference in this release
`At5g48560`	Transcription factor that binds DNA to G box 5'-CACGTG-3' and to E-box 5'-CANNTG-3' (By similarity).	Multiple bHLH proteins form heterodimers to mediate CRY2-dependent regulation of flowering-time in Arabidopsis.2013 · DOI: 10.1371/journal.pgen.1003861
`At3g23690`	Transcription factor bHLH77.	No verified direct reference in this release
`At1g10120`	Transcriptional activator involved in cell elongation.	Multiple bHLH proteins form heterodimers to mediate CRY2-dependent regulation of flowering-time in Arabidopsis.2013 · DOI: 10.1371/journal.pgen.1003861
`At1g26260`	Transcriptional activator involved in cell elongation.	Multiple bHLH proteins form heterodimers to mediate CRY2-dependent regulation of flowering-time in Arabidopsis.2013 · DOI: 10.1371/journal.pgen.1003861

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000798 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009637 response to blue light Biological Process

GO:0009911 positive regulation of flower development Biological Process

GO:0005634 nucleus Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0003677 DNA binding Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

GO:0046983 protein dimerization activity Molecular Function

KEGG gene cross-reference

ath:AT1G26260

ath:AT1G68920

ath:AT3G07340

ath:AT3G23690

ath:AT5G48560

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.972

Rank 1 · TkA01G586780 · TK1151

Cytoplasm0.098

Rank 2 · TkA01G586780 · TK1151

Cell membrane0.027

Rank 3 · TkA01G586780 · TK1151

Endoplasmic reticulum0.014

Rank 4 · TkA01G586780 · TK1151

Plastid0.012

Rank 5 · TkA01G586780 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF15576DUF4661224-310 aa

PF23177bHLH_IRO3322-376 aa

PF00010HLH323-370 aa

PF23173bHLH_SAC51328-372 aa

PF23174bHLH_ILI333-383 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G586780	`PF15576`	DUF4661	224	310	1.7	9.2
TkA01G586780	`PF23177`	bHLH_IRO3	322	376	0.027	15.5
TkA01G586780	`PF00010`	HLH	323	370	4.1e-06	27.2
TkA01G586780	`PF23173`	bHLH_SAC51	328	372	1.9e-05	25.2
TkA01G586780	`PF23174`	bHLH_ILI	333	383	0.013	16.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SRT2`	Arabidopsis thaliana	sp\|Q9SRT2\|BH062_ARATH Transcription factor bHLH62	39.800%	Swiss-Prot	Medium
`Q9FJL4`	Arabidopsis thaliana	sp\|Q9FJL4\|BH078_ARATH Transcription factor bHLH78	36.500%	Swiss-Prot	Medium
`Q9LK48`	Arabidopsis thaliana	sp\|Q9LK48\|BH077_ARATH Transcription factor bHLH77	58.200%	Swiss-Prot	Low
`Q6NKN9`	Arabidopsis thaliana	sp\|Q6NKN9\|BH074_ARATH Transcription factor bHLH74	51.900%	Swiss-Prot	Low
`Q9C670`	Arabidopsis thaliana	sp\|Q9C670\|BH076_ARATH Transcription factor bHLH76	42.100%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card